GPX4 Protein, Human (HEK293, Flag)

GPX4 Protein, Human (HEK293, Flag) is the recombinant human-derived GPX4 protein, expressed by HEK293, with N-Flag tag.

GPX4 is an essential antioxidant peroxidase that directly reduces phospholipid hydroperoxides, including those incorporated in membranes and lipoproteins (By similarity). It also reduces cholesterol hydroperoxide and thymine hydroperoxide (By similarity), playing a key role in protecting cells from oxidative damage by preventing membrane lipid peroxidation (By similarity). GPX4 is required to inhibit ferroptosis, a non-apoptotic cell death caused by iron-dependent accumulation of lipid reactive oxygen species (PubMed:24439385). The presence of selenocysteine (Sec) versus cysteine (Cys) at the active site is critical for life, as it provides resistance to overoxidation and prevents ferroptosis (By similarity). Sec is also essential for the survival of parvalbumin-positive interneurons, thereby preventing fatal epileptic seizures (By similarity). GPX4 may protect cells from the toxicity of ingested lipid hydroperoxides (By similarity) and is indispensable for normal sperm development, male fertility (By similarity), and photoreceptor cell maturation and survival (By similarity). In T-cell responses to viral and parasitic infections, GPX4 prevents ferroptosis and supports T-cell expansion (By similarity). Additionally, it functions as a glutathione peroxidase in platelets during arachidonic acid metabolism (PubMed:11115402) and reduces hydroperoxy ester lipids formed by 15-lipoxygenase, downregulating the cellular 15-lipoxygenase pathway (By similarity). GPX4 can also reduce fatty acid-derived hydroperoxides (PubMed:11115402, PubMed:36608588) and small soluble hydroperoxides such as H2O2, cumene hydroperoxide, and tert-butyl hydroperoxide (PubMed:17630701, PubMed:36608588).

GXP4 activity is measured indirectly. GXP4 converts reduced glutathione (GSH) to oxidized glutathione (GSSG) by reducing hydroperoxide (ROOH). GSSG is then converted back to its reduced form by glutathione reductase (GR) in the presence of NAPDH, which is converted into NADP+. NADPH is intrinsically fluorescent, a property lost upon oxidation to NADP+. The fluorescence signal is inversely proportional to the enzyme concentration. This is because with high GPX4 concentrations, you have more NADPH (fluorescent molecule) converting to NADP+.

Human

HEK293

N-Flag

P36969-1 (C29-F197, U73C)

2879

Full Length of Isoform-1 Mature Protein

CASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF

Approximately 21 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of 40 mM Tris-HCl, pH 8.0, 110 mM NaCl, 2.2 mM KCl, 20% glycerol, and 100 µg/ml FLAG peptide.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.