1. Recombinant Proteins
  2. Receptor Proteins
  3. GPVI Protein, Human (HEK293, His)

GPVI protein is a collagen receptor that mediates collagen-induced platelet adhesion and activation and plays a crucial role in procoagulant activity, thrombin generation, and fibrin formation. GPVI Protein, Human (HEK293, His) is the recombinant human-derived GPVI protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample (5 μg)   Apply now
5 μg In-stock
10 μg In-stock
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

GPVI protein is a collagen receptor that mediates collagen-induced platelet adhesion and activation and plays a crucial role in procoagulant activity, thrombin generation, and fibrin formation. GPVI Protein, Human (HEK293, His) is the recombinant human-derived GPVI protein, expressed by HEK293 , with C-His labeled tag.

Background

The GPVI protein functions as a collagen receptor crucially involved in mediating collagen-induced platelet adhesion and activation. It plays a pivotal role in platelet procoagulant activity, leading to subsequent thrombin and fibrin formation, thereby contributing to arterial and venous thrombus formation. The signaling pathway involves the FcR gamma-chain, the Src kinases (likely FYN or LYN), SYK, the adapter protein LAT, and culminates in the activation of PLCG2. GPVI is associated with the Fc receptor gamma chain, forming the GPVI:FcRgamma complex that is further linked to the Src kinase family FYN and LYN. Additionally, GPVI interacts with TRAF4 and specifically binds to COL1A1, highlighting its involvement in intricate signaling cascades and its association with collagen molecules, particularly COL1A1, which is integral to its collagen-binding function.

Biological Activity

Measured by its binding ability in a functional ELISA. When Bovine Collagen I is immobilized, Human GPVI binds with an ED50 of 0.4252 μg/mL, corresponding to a specific activity is 2.35×10^3 units/mg.

  • Measured by its binding ability in a functional ELISA. When Bovine Collagen I is immobilized, Human GPVI binds with an ED50 of 0.4252 μg/mL, corresponding to a specific activity is 2.35×103 units/mg.
Species

Human

Source

HEK293

Tag

C-His

Accession

Q9HCN6-1 (Q21-K267)

Gene ID
Molecular Construction
N-term
GPVI (Q21-K267)
Accession # Q9HCN6-1
His
C-term
Synonyms
GPVI; Gp6; Glycoprotein 6; MGC138168
AA Sequence

QSGPLPKPSLQALPSSLVPLEKPVTLRCQGPPGVDLYRLEKLSSSRYQDQAVLFIPAMKRSLAGRYRCSYQNGSLWSLPSDQLELVATGVFAKPSLSAQPGPAVSSGGDVTLQCQTRYGFDQFALYKEGDPAPYKNPERWYRASFPIITVTAAHSGTYRCYSFSSRDPYLWSAPSDPLELVVTGTSVTPSRLPTEPPSPVAEFSEATAELTVSFTNEVFTTETSRSITASPKESDSPAGPARQYYTK

Molecular Weight

40-60 kDa

Purity
  • Greater than 95% as determined by Tris-Bis PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4 or 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

GPVI Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GPVI Protein, Human (HEK293, His)
Cat. No.:
HY-P77952
Quantity:
MCE Japan Authorized Agent: