GPA33 Protein, Cynomolgus (HEK293, His)

The GPA33 protein may play a role in fundamental cellular processes, particularly in intercellular recognition and signaling, suggesting its involvement in intercellular communication. The exact mechanism by which GPA33 functions in these processes remains an area of interest, emphasizing its potential importance in mediating molecular interactions that contribute to cellular responses. GPA33 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived GPA33, expressed by HEK293, with C-His labeled tag. The total length of GPA33 Protein, Cynomolgus (HEK293, His) is 214 a.a..

The GPA33 protein is implicated in potentially playing a role in cell-cell recognition and signaling, suggesting its involvement in fundamental cellular processes related to intercellular communication. The precise mechanisms by which GPA33 operates in cell-cell recognition and signaling remain areas of interest, underscoring its potential significance in mediating molecular interactions that contribute to cellular responses. The versatile nature of GPA33 in these processes highlights its potential role in coordinating cellular recognition events and modulating signaling cascades, emphasizing the need for further exploration to elucidate its specific functions and molecular mechanisms.

Immobilized Cynomolgus GPA33 His at 1 μg/mL (100 μL/well) can bind Monoclonal Anti-Human GPA33 Antibody Human IgG1 with a linear range of 0.2-2 ng/mL.

Cynomolgus

HEK293

C-His

G7NU40-1 (I38-V251)

101867278  [NCBI]

Partial

WPVLWTLCAVRVTVNAITVETSQNVLRALHGKSVTLPCTYHTSTSSREGLIQWDKLLFTHTERVVIWQFSNKDYIYGELYKNRVNISSNVEQSDASITIDQLTMADNGTYECSVSLMSDLDGTTKSRVRLLVLLPPSKPECGIEGETIIGNDIQLTCQSKEGSPTPQYSWKRYDILNQEQPLAQPASGQPVSLKNVSTDTSGYYICTSSNEAGI

Approximately 35-38 kDa & 40-45 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized a 0.22 μm filtered solution of PBS, pH 7.4 . Normally trehalose is added as protectant before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.