GNMT Protein, Human (His)

Glycine N-methyltransferase (GNMT) is responsible for catalyzing the methylation of glycine, using S-adenosylmethionine (AdoMet) to generate N-methylglycine (sarcosine), and simultaneously producing S-adenosyl homocysteine AdoHcy. This reaction is complexly regulated by 5-methyltetrahydrofolate binding, highlighting the critical role of GNMT in the regulation of methyl metabolism. GNMT Protein, Human (His) is the recombinant human-derived GNMT protein, expressed by E. coli , with N-6*His labeled tag.

Glycine N-methyltransferase (GNMT) is an enzyme that catalyzes the methylation of glycine using S-adenosylmethionine (AdoMet) as a methyl donor, resulting in the formation of N-methylglycine (sarcosine) and S-adenosylhomocysteine (AdoHcy). This reaction is crucial in the regulation of methyl group metabolism, as GNMT plays a key role in maintaining the balance between S-adenosyl-L-methionine and S-adenosyl-L-homocysteine levels. The enzyme is involved in the regulation of one-carbon metabolism and contributes to the control of the cellular methylation potential. The binding of 5-methyltetrahydrofolate is implicated in modulating the activity of GNMT, highlighting its role in coordinating methyl group utilization and homeostasis.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

E. coli

N-6*His

Q14749 (M1-D295)

27232  [NCBI]

Full Length

MVDSVYRTRSLGVAAEGLPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCQRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRHEPAFDKWVIEEANWMTLDKDVPQSAEGGFDAVICLGNSFAHLPDCKGDQSEHRLALKNIASMVRAGGLLVIDHRNYDHILSTGCAPPGKNIYYKSDLTKDVTTSVLIVNNKAHMVTLDYTVQVPGAGQDGSPGLSKFRLSYYPHCLASFTELLQAAFGGKCQHSVLGDFKPYKPGQTYIPCYFIHVLKRTD

Approximately 33-37 kDa,based on SDS-PAGE under reducing conditions.

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.