1. Recombinant Proteins
  2. Cytokines and Growth Factors GMP-grade Proteins
  3. GMP TPO/Thrombopoietin Protein, Human (HEK293, His)

GMP TPO/Thrombopoietin Protein, Human (HEK293, His)

Cat. No.: HY-P70637G
Handling Instructions Technical Support

TPO/Thrombopoietin Protein, a lineage-specific cytokine, significantly influences megakaryocyte proliferation and maturation, particularly in late developmental stages from committed progenitor cells. It emerges as a potential major physiological regulator, underscoring its crucial role in the intricate orchestration of circulating platelets and emphasizing its importance in megakaryocyte biology and platelet formation. GMP TPO/Thrombopoietin Protein, Human (HEK293, His) is the recombinant human-derived TPO/Thrombopoietin protein, expressed by HEK293 , with C-6*His labeled tag.

GMP-grade recombinant proteins are produced under independent QA supervision, as well as quality records and full traceability.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TPO/Thrombopoietin Protein, a lineage-specific cytokine, significantly influences megakaryocyte proliferation and maturation, particularly in late developmental stages from committed progenitor cells. It emerges as a potential major physiological regulator, underscoring its crucial role in the intricate orchestration of circulating platelets and emphasizing its importance in megakaryocyte biology and platelet formation. GMP TPO/Thrombopoietin Protein, Human (HEK293, His) is the recombinant human-derived TPO/Thrombopoietin protein, expressed by HEK293 , with C-6*His labeled tag.

Background

Thrombopoietin (TPO), a lineage-specific cytokine, exerts a pivotal influence on the proliferation and maturation of megakaryocytes, particularly at the late stages of their development from committed progenitor cells. Notably, TPO emerges as a potential major physiological regulator in the intricate orchestration of circulating platelets, underscoring its crucial role in megakaryocyte biology and platelet formation.

Biological Activity

Measured by Mo7e human giant cell leukemia cell proliferation method, the specific activity should be great than 1×10^5 IU/mg.

Species

Human

Source

HEK293

Tag

N-6*His;C-6*His

Accession

P40225 (S22-G353)

Gene ID
Molecular Construction
N-term
TPO (S22-G353)
Accession # P40225
6*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Thrombopoietin; C-mpl ligand; MGDF; THPO
AA Sequence

SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG

Molecular Weight

70-90 kDa

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris, 150 mM NaCl, pH 8.0.

Endotoxin Level

<0.1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in injection water.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

GMP TPO/Thrombopoietin Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GMP TPO/Thrombopoietin Protein, Human (HEK293, His)
Cat. No.:
HY-P70637G
Quantity:
MCE Japan Authorized Agent: