1. Recombinant Proteins
  2. Cytokines and Growth Factors GMP-grade Proteins
  3. Interleukin & Receptors
  4. IL-7
  5. GMP IL-7 Protein, Human (HEK293, His)

IL-7 protein is an important hematopoietic cytokine that is essential for the development, expansion and survival of T cells and B cells, regulating mature lymphocyte populations and maintaining lymphatic homeostasis. IL-7 interacts with IL7RA and CSF2RG subunits, activates kinases, including JAK1 or JAK3, and initiates signaling cascades, such as the PI3K/Akt/mTOR or JAK-STAT5 pathway. GMP IL-7 Protein, Human (HEK293, His) is the recombinant human-derived IL-7 protein, expressed by HEK293 , with C-6*His labeled tag.

GMP-grade recombinant proteins are produced under independent QA supervision, as well as quality records and full traceability.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-7 protein is an important hematopoietic cytokine that is essential for the development, expansion and survival of T cells and B cells, regulating mature lymphocyte populations and maintaining lymphatic homeostasis. IL-7 interacts with IL7RA and CSF2RG subunits, activates kinases, including JAK1 or JAK3, and initiates signaling cascades, such as the PI3K/Akt/mTOR or JAK-STAT5 pathway. GMP IL-7 Protein, Human (HEK293, His) is the recombinant human-derived IL-7 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

The IL-7 protein serves as a crucial hematopoietic cytokine, playing an indispensable role in the development, expansion, and survival of both naive and memory T-cells as well as B-cells, thereby regulating the population of mature lymphocytes and maintaining lymphoid homeostasis. Its biological effects are executed through a receptor comprised of the IL7RA subunit and the cytokine receptor common subunit gamma/CSF2RG. Upon binding to the receptor, IL-7 activates various kinases, including JAK1 or JAK3, depending on the cell type. This activation leads to the propagation of signals through multiple downstream pathways, such as the PI3K/Akt/mTOR or the JAK-STAT5 pathways. IL-7's interaction with IL7R and CSF2RG highlights its pivotal role in orchestrating diverse signaling cascades crucial for immune cell development and function.

Biological Activity

The specific activity is > 2×10 6 U/mg.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P13232-1 (D26-H177)

Gene ID
Molecular Construction
N-term
IL-7 (D26-H177)
Accession # P13232-1
6*His
C-term
Protein Length

Full Length of Isoform-1 Mature Protein

Synonyms
Interleukin-7; IL-7; IL7
AA Sequence

DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH

Predicted Molecular Mass
18.4 kDa
Molecular Weight

Approximately 19-30 kDa,based on SDS-PAGE under reducing conditions.

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<0.1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in injection water.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

GMP IL-7 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GMP IL-7 Protein, Human (HEK293, His)
Cat. No.:
HY-P70755G
Quantity:
MCE Japan Authorized Agent: