1. Recombinant Proteins
  2. Cytokines and Growth Factors GMP-grade Proteins
  3. IGF family
  4. Insulin-like Growth Factor I (IGF-1)
  5. GMP LR3 IGF-I/IGF-1 Protein, Human (83a.a, E51R)

GMP LR3 IGF-I/IGF-1 Protein, Human (83a.a, E51R)

Cat. No.: HY-P70783G
Handling Instructions Technical Support

The LR3 IGF-I/IGF-1 protein is similar to insulin and has potent growth-promoting activity that exceeds the efficacy of insulin. As a potential physiological regulator, it stimulates glucose transport and glycogen synthesis in osteoblasts even at significantly lower concentrations than insulin. GMP LR3 IGF-I/IGF-1 Protein, Human (83a.a, E51R) is the recombinant human-derived LR3 IGF-I/IGF-1 protein, expressed by E. coli , with tag free.

GMP-grade recombinant proteins are produced under independent QA supervision, as well as quality records and full traceability.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The LR3 IGF-I/IGF-1 protein is similar to insulin and has potent growth-promoting activity that exceeds the efficacy of insulin. As a potential physiological regulator, it stimulates glucose transport and glycogen synthesis in osteoblasts even at significantly lower concentrations than insulin. GMP LR3 IGF-I/IGF-1 Protein, Human (83a.a, E51R) is the recombinant human-derived LR3 IGF-I/IGF-1 protein, expressed by E. coli , with tag free.

Background

The LR3 IGF-I/IGF-1 protein, structurally and functionally akin to insulin, boasts significantly heightened growth-promoting activity compared to its counterpart. Positioned as a potential physiological regulator, LR3 IGF-I may govern [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts, demonstrating effective stimulation of glucose transport in bone-derived osteoblastic (PyMS) cells even at markedly lower concentrations than insulin. Its multifaceted roles extend to potential involvement in synapse maturation and the Ca(2+)-dependent exocytosis essential for sensory perception of smell in the olfactory bulb. Operating as a ligand for IGF1R, LR3 IGF-I binds to the alpha subunit, initiating the activation of intrinsic tyrosine kinase activity, autophosphorylating tyrosine residues in the beta subunit. This activation triggers a cascade of downstream signaling events leading to the activation of the PI3K-AKT/PKB and Ras-MAPK pathways. Further, LR3 IGF-I forms crucial ternary complexes with integrins (ITGAV:ITGB3 and ITGA6:ITGB4) and IGFR1, essential for comprehensive IGF1 signaling, influencing the phosphorylation and activation of IGFR1, MAPK3/ERK1, MAPK1/ERK2, and AKT1. It also exhibits diverse molecular interactions, including with SH2D3C isoform 2.

Biological Activity

Measured in a serum-free cell proliferation assay using MCF-7 human breast cancer cells.The specific activity is > 1×106 U/mg.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

P05019-1 (G49-A118, E51R, with a 13 amino acid extension peptide at the N terminal)

Gene ID
Molecular Construction
N-term
IGF1 (G49-A118)
Accession # P05019
C-term
Protein Length

Full Length of Isoform-1 Mature Protein

Synonyms
Long R3 IGF-I; Insulin-like growth factor I; MGF; Somatomedin-C; IBP1
AA Sequence

MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Molecular Weight

Approximately 11 KDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM NaAc-HAc, 4% mannitol, pH 4.5.

Endotoxin Level

<0.1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in injection water.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

GMP LR3 IGF-I/IGF-1 Protein, Human (83a.a, E51R) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GMP LR3 IGF-I/IGF-1 Protein, Human (83a.a, E51R)
Cat. No.:
HY-P70783G
Quantity:
MCE Japan Authorized Agent: