1. Recombinant Proteins
  2. Cytokines and Growth Factors GMP-grade Proteins
  3. GMP FLT3LG Protein, Human (HEK293, His)

FLT3LG protein, a potent stimulator of early hematopoietic cell proliferation, activates FLT3 and synergizes with colony-stimulating factors and interleukins. As a homodimer, especially in isoform 2, it crucially promotes expansion and differentiation of hematopoietic progenitor cells. FLT3LG's collaborative signaling with other molecules underscores its significance in regulating hematopoiesis and maintaining hematopoietic system balance. GMP FLT3LG Protein, Human (HEK293, His) is the recombinant human-derived FLT3LG protein, expressed by HEK293 , with C-6*His labeled tag.

GMP-grade recombinant proteins are produced under independent QA supervision, as well as quality records and full traceability.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

FLT3LG protein, a potent stimulator of early hematopoietic cell proliferation, activates FLT3 and synergizes with colony-stimulating factors and interleukins. As a homodimer, especially in isoform 2, it crucially promotes expansion and differentiation of hematopoietic progenitor cells. FLT3LG's collaborative signaling with other molecules underscores its significance in regulating hematopoiesis and maintaining hematopoietic system balance. GMP FLT3LG Protein, Human (HEK293, His) is the recombinant human-derived FLT3LG protein, expressed by HEK293 , with C-6*His labeled tag.

Background

FLT3LG protein serves as a potent stimulator of early hematopoietic cell proliferation through the activation of FLT3, demonstrating synergistic effects when combined with various colony-stimulating factors and interleukins. This homodimeric protein, particularly in isoform 2, plays a crucial role in promoting the expansion and differentiation of hematopoietic progenitor cells. Its ability to activate FLT3 and collaborate with other signaling molecules underscores its significance in regulating hematopoiesis and maintaining the balance of the hematopoietic system.

Biological Activity

Immobilized Human Flt-3 Ligand at 5 μg/mL (100 μL/well) can bind Human FLT3 (C-Fc).The specific activity is >1×106 U/mg.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P49771-1 (T27-P184)

Gene ID
Molecular Construction
N-term
GMP FLT3LG (T27-P184)
Accession # P49771-1
6*His
C-term
Protein Length

Extracellular Domain

Synonyms
Fms-related tyrosine kinase 3 ligand; Flt3L; SL cytokine; FLT3LG
AA Sequence

TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQP

Molecular Weight

24-32kDa

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<0.05 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in injection water.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

GMP FLT3LG Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GMP FLT3LG Protein, Human (HEK293, His)
Cat. No.:
HY-P70544G
Quantity:
MCE Japan Authorized Agent: