1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Neurotrophic Factors
  4. GMFG Protein, Human (His)

GMFG protein shows predominant expression in the lung, heart, and placenta, emphasizing its important role in these important tissues. As a member of the ADF family of actin-binding proteins within the GMF subfamily, GMFG is involved in cellular processes related to actin dynamics. GMFG Protein, Human (His) is the recombinant human-derived GMFG protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

GMFG protein shows predominant expression in the lung, heart, and placenta, emphasizing its important role in these important tissues. As a member of the ADF family of actin-binding proteins within the GMF subfamily, GMFG is involved in cellular processes related to actin dynamics. GMFG Protein, Human (His) is the recombinant human-derived GMFG protein, expressed by E. coli , with N-6*His labeled tag.

Background

The GMFG protein, belonging to the actin-binding proteins ADF family within the GMF subfamily, is primarily expressed in specific tissues, with a predominant presence noted in the lung, heart, and placenta. As a member of the actin-depolymerizing factor (ADF) family, GMFG likely participates in regulating actin dynamics, a critical process essential for cellular structure, motility, and various intracellular activities. The distinct expression pattern in vital organs suggests potential roles for GMFG in processes such as cell migration, tissue development, or physiological functions specific to the lung, heart, and placenta. Further investigations into GMFG's precise molecular functions and interactions within these tissues could provide valuable insights into its contributions to cellular dynamics and organ-specific processes.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

O60234 (S2-R142)

Gene ID
Molecular Construction
N-term
6*His
GMFG (S2-R142)
Accession # O60234
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Glia maturation factor gamma; GMF-gamma; GMFG
AA Sequence

SDSLVVCEVDPELTEKLRKFRFRKETDNAAIIMKVDKDRQMVVLEEEFQNISPEELKMELPERQPRFVVYSYKYVHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNRLVQTAELTKVFEIRTTDDLTEAWLQEKLSFFR

Predicted Molecular Mass
17 kDa
Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

GMFG Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GMFG Protein, Human (His)
Cat. No.:
HY-P76367
Quantity:
MCE Japan Authorized Agent: