1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Neurotrophic Factors
  4. GMF-beta Protein, Mouse

GMF-β protein is a multifaceted regulatory factor that coordinates brain cell differentiation, stimulates neuroregeneration, and inhibits tumor cell proliferation. Phosphorylation initiated by phorbol esters is critical for its activity, suggesting a dynamic regulatory mechanism in response to external signals. GMF-beta Protein, Mouse is the recombinant mouse-derived GMF-beta protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

GMF-β protein is a multifaceted regulatory factor that coordinates brain cell differentiation, stimulates neuroregeneration, and inhibits tumor cell proliferation. Phosphorylation initiated by phorbol esters is critical for its activity, suggesting a dynamic regulatory mechanism in response to external signals. GMF-beta Protein, Mouse is the recombinant mouse-derived GMF-beta protein, expressed by E. coli , with tag free.

Background

GMF-beta protein emerges as a multifaceted regulator, orchestrating the differentiation of brain cells, stimulating neural regeneration, and concurrently inhibiting the proliferation of tumor cells. This versatile protein undergoes phosphorylation, a modification crucial for its activity and notably triggered by phorbol ester. The phosphorylated state of GMF-beta suggests a dynamic regulatory mechanism responsive to external signals, potentially playing a pivotal role in cellular signaling cascades. With its dual capacity to influence both neural development and impede tumor cell proliferation, GMF-beta stands out as a crucial player in the intricate modulation of cellular fate and function, holding promise for further exploration in understanding and manipulating these fundamental biological processes.

Species

Mouse

Source

E. coli

Tag

Tag Free

Accession

Q9CQI3 (S2-H142)

Gene ID
Molecular Construction
N-term
GMF-beta (S2-H142)
Accession # Q9CQI3
C-term
Synonyms
Glia maturation factor beta; GMF-beta; Gmfb
AA Sequence

SESLVVCDVAEDLVEKLRKFRFRKETHNAAIIMKIDKDERLVVLDEELEGVSPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFH

Molecular Weight

Approximately 19.7 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg; determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

GMF-beta Protein, Mouse Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GMF-beta Protein, Mouse
Cat. No.:
HY-P72801
Quantity:
MCE Japan Authorized Agent: