1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. CSF & Receptors
  4. GM-CSF
  5. GM-CSF Protein, Rhesus macaque

GM-CSF Protein, Rhesus macaque functions as a cytokine and affects many cell types, especially macrophages and eosinophils.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

GM-CSF Protein, Rhesus macaque functions as a cytokine and affects many cell types, especially macrophages and eosinophils.

Background

Granulocyte Macrophage Colony Stimulating Factor (GM-CSF) is a monomeric glycoprotein that functions as a cytokine —it is a white blood cell growth factor[1]. GM-CSF stimulates stem cells to produce granulocytes (neutrophils, eosinophils, and basophils) and monocytes. Monocytes exit the circulation and migrate into tissue, whereupon they mature into macrophages and dendritic cells. GM-CSF also has some effects on mature cells of the immune system. These include, for example, inhibiting neutrophil migration and causing an alteration of the receptors expressed on the cells surface[2]. GM-CSF also plays a role in embryonic development by functioning as an embryokine produced by reproductive tract[3].

Biological Activity

The ED50 is <0.1 ng/mL as measured by human TF-1 cells, corresponding to a specific activity of >1.0 × 107 units/mg.

  • Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. . The ED50 for this effect is 23.60 pg/mL, corresponding to a specific activity is 4.24×107 units/mg.
Species

Rhesus Macaque

Source

E. coli

Tag

Tag Free

Accession

Q9GL44 (A18-E144)

Gene ID
Molecular Construction
N-term
GM-CSF (A18-E144)
Accession # Q9GL44
C-term
Protein Length

Full Length of Mature Protein

Synonyms
rRhGM-CSF; CSF2; Colony stimulating factor 2
AA Sequence

APARSPSPGTQPWEHVNAIQEARRLLNLSRDTAAEMNKTVEVVSEMFDLQEPSCLQTRLELYKQGLQGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFQSFKENLKDFLLVIPFDCWEPVQE

Predicted Molecular Mass
14.4 kDa
Molecular Weight

Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4 or 50 mM Tris-HCl, 300 mM NaCl, pH 8.0 or PBS, pH 7.4, 8% trehalose.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

GM-CSF Protein, Rhesus macaque Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GM-CSF Protein, Rhesus macaque
Cat. No.:
HY-P7184
Quantity:
MCE Japan Authorized Agent: