1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. CSF & Receptors
  4. GM-CSF
  5. GM-CSF Protein, Rat (CHO)

GM-CSF Protein, Rat (CHO) is a hematopoietic growth factor and immune modulator.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

GM-CSF Protein, Rat (CHO) is a hematopoietic growth factor and immune modulator.

Background

Granulocyte-macrophage colony-stimulating factor (GM-CSF) is produced by a variety of cell types including T cells, macrophages, endothelial cells and fibroblasts upon receiving immune stimuli. It is an important hematopoietic growth factor and immune modulator. GM-CSF also has profound effects on the functional activities of various circulating leukocytes. GM-CSF stimulates multipotent progenitor cells depending on its concentration, the proliferation of macrophage progenitors at the lowest doses, followed by granulocyte, erythroid, eosinophil, megakaryocyte and multipotent progenitors. It also stimulates the differentiation of myeloid leukemic cells and controls eosinophil function in some instances[1][2]. GM-CSF also enhances the functionality of mature cells, such as neutrophils. In neutrophils, GM-CSF potentiates degranulation, the release of oxygen and nitrogen radical ions, phagocytosis, and inhibits apoptosis[3]. GM-CSF inhibition in some animal models of autoimmune diseases showed significant beneficial effects[4]. GM-CSF also has many pro-inflammatory functions and recent data implicates GM-CSF as a key factor in Th17 driven autoimmune inflammatory conditions[5].

Biological Activity

1.The ED50 is <5 pg/mL as measured by FDC-P1 cells, corresponding to a specific activity of >2 × 108 units/mg.
2.Measured in a cell proliferation assay using M-NFS-60 mouse myelogenous leukemia lymphoblast cells. The ED50 for this effect is 5.019 pg/mL, corresponding to a specific activity is 1.99×108 units/mg.

  • Measured in a cell proliferation assay using M‑NFS‑60 mouse myelogenous leukemia lymphoblast cells. The ED50 for this effect is 5.019 pg/mL, corresponding to a specific activity is 1.99×108 units/mg.
Species

Rat

Source

CHO

Tag

Tag Free

Accession

P48750 (A18-K144)

Gene ID
Molecular Construction
N-term
GM-CSF (A18-K144)
Accession # P48750
C-term
Synonyms
rRtGM-CSF; CSF-2; MGI-1GM; Pluripoietin-alpha; Molgramostin; Sargramostim
AA Sequence

APTRSPNPVTRPWKHVDAIKEALSLLNDMRALENEKNEDVDIISNEFSIQRPTCVQTRLKLYKQGLRGNLTKLNGALTMIASHYQTNCPPTPETDCEIEVTTFEDFIKNLKGFLFDIPFDCWKPVQK

Molecular Weight

16-26 kDa

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS or 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

GM-CSF Protein, Rat (CHO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GM-CSF Protein, Rat (CHO)
Cat. No.:
HY-P7094
Quantity:
MCE Japan Authorized Agent: