1. Recombinant Proteins
  2. Viral Proteins
  3. RSV Proteins
  4. RSV G proteins
  5. Glycoprotein/G Protein, HRSV (95% Homology, HEK293, His)

Glycoprotein/G Protein, HRSV (95% Homology, HEK293, His)

Cat. No.: HY-P75814
Handling Instructions Technical Support

A glycoprotein/G protein critical in the immune response forms the interleukin-31 receptor with OSMR.This receptor activates STAT3 and, to a lesser extent, STAT1 and STAT5, playing a critical role in skin immunity and mediating IL31-induced itch, possibly involving TRPA1 and TRPV1.Glycoprotein/G Protein, HRSV (95% Homology, HEK293, His) is the recombinant Virus-derived Glycoprotein/G protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

A glycoprotein/G protein critical in the immune response forms the interleukin-31 receptor with OSMR.This receptor activates STAT3 and, to a lesser extent, STAT1 and STAT5, playing a critical role in skin immunity and mediating IL31-induced itch, possibly involving TRPA1 and TRPV1.Glycoprotein/G Protein, HRSV (95% Homology, HEK293, His) is the recombinant Virus-derived Glycoprotein/G protein, expressed by HEK293 , with C-His labeled tag.

Background

The glycoprotein/G Protein, a crucial component of the immune response, forms the interleukin-31 receptor by associating with OSMR. This receptor plays a vital role in activating STAT3, as well as STAT1 and STAT5 to a lesser extent. It is known to be involved in skin immunity and is responsible for mediating IL31-induced itch, potentially by relying on cation channels TRPA1 and TRPV1. Moreover, the glycoprotein/G Protein positively regulates the numbers and cycling status of immature subsets of myeloid progenitor cells in the bone marrow, both in vivo and in vitro, thereby enhancing myeloid progenitor cell survival. It forms a heterodimer with OSMR and interacts with JAK1 and STAT3 to carry out its functions. In terms of viral infection, this glycoprotein/G Protein attaches the virion to the host cell membrane by interacting with heparan sulfate, initiating the infection process. It also interacts with host CX3CR1, the receptor for the CX3C chemokine fractalkine, to modulate the immune response and facilitate infection. Unlike other paramyxovirus attachment proteins, it lacks both neuraminidase and hemagglutinating activities. Additionally, it aids the virus in escaping antibody-dependent restriction of replication by acting as an antigen decoy and modulating the activity of leukocytes bearing Fc-gamma receptors.

Biological Activity

Loaded Vesencumab (HY-P99386) on AHC2 biosensor, can bind Glycoprotein/G Protein, HRSV (95% Homology, HEK293, His) with an affinity constant of 1.372E-09 M as determined in BLI assay.

  • Loaded Vesencumab (HY-P99386) on AHC2 biosensor, can bind Glycoprotein/G Protein, HRSV (95% Homology, HEK293, His) with an affinity constant of 1.372E-09 M as determined in BLI assay.
Species

Virus

Source

HEK293

Tag

C-His

Accession

P27022 (N66-R297)

Gene ID

/

Molecular Construction
N-term
HRSV G (N66-R297)
Accession # P27022
His
C-term
Protein Length

Partial

Synonyms
Human respiratory syncytial virus (RSV) (A, rsb1734) glycoprotein G / RSV-G Protein (95% Homology)
AA Sequence

NHKITSTTTIIQDATNQIKNTTPTYLTQNPQLGISPSNPSDITSLITTILDSTTPGVKSTLQSTTVGTKNTTTTQAQPNKPTTKQRQNKPPSKPNNDFHFEVFNFVPCSICSNNPTCWAICKRIPNKKPGKRTTTKPTKKPTPKTTKKGPKPQTTKSKEAPTTKPTEEPTINTTKTNIITTLLTSNTTRNPELTSQMETFHSTSSEGNPSPSQVSITSEYPSQPSSPPNTPR

Molecular Weight

approximately 50-100 kDa due to the glycosylation

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Glycoprotein/G Protein, HRSV (95% Homology, HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Glycoprotein/G Protein, HRSV (95% Homology, HEK293, His)
Cat. No.:
HY-P75814
Quantity:
MCE Japan Authorized Agent: