1. Recombinant Proteins
  2. Viral Proteins
  3. glycoprotein G/gG Protein, HHV-1 (Cell-Free, His)

glycoprotein G/gG Protein, HHV-1 (Cell-Free, His)

Cat. No.: HY-P702297
Handling Instructions Technical Support

The glycoprotein G/gG protein, functioning as a chemokine-binding protein, critically modulates immune responses by inhibiting neutrophil chemotaxis. It prevents the migration of neutrophils in response to chemokine signals, contributing to the fine-tuned control of immune cell recruitment and positioning within tissues. This highlights the protein's significance in orchestrating the immune system and maintaining immune homeostasis. glycoprotein G/gG Protein, HHV-1 (Cell-Free, His) is the recombinant Virus-derived glycoprotein G/gG protein, expressed by E. coli Cell-free , with N-10*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The glycoprotein G/gG protein, functioning as a chemokine-binding protein, critically modulates immune responses by inhibiting neutrophil chemotaxis. It prevents the migration of neutrophils in response to chemokine signals, contributing to the fine-tuned control of immune cell recruitment and positioning within tissues. This highlights the protein's significance in orchestrating the immune system and maintaining immune homeostasis. glycoprotein G/gG Protein, HHV-1 (Cell-Free, His) is the recombinant Virus-derived glycoprotein G/gG protein, expressed by E. coli Cell-free , with N-10*His labeled tag.

Background

The glycoprotein G/gG protein serves as a chemokine-binding protein, exerting its function by inhibiting the chemotaxis of neutrophils. This protein plays a critical role in modulating the movement of neutrophils, preventing their migration in response to chemokine signals. By acting as a regulator of neutrophil chemotaxis, glycoprotein G/gG contributes to the fine-tuned control of immune responses, influencing the recruitment and positioning of immune cells within tissues. This inhibition of neutrophil chemotaxis highlights the protein's significance in the intricate orchestration of the immune system and its potential role in maintaining immune homeostasis.

Species

Virus

Source

E. coli Cell-free

Tag

N-10*His

Accession

P06484 (V25-G238)

Gene ID

2703404

Molecular Construction
N-term
10*His
HHV-2 gG (V25-G238)
Accession # P06484
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Envelope glycoprotein G; gG-1
AA Sequence

VPTNVSSTTQPQLQTTGRPSHEAPNMTQTGTTDSPTAISLTTPDHTPPMPSIGLEEEEEEEGAGDGEHLEGGDGTRDTLPQSPGPAFPLAEDVEKDKPNRPVVPSPDPNNSPARPETSRPKTPPTIIGPLATRPTTRLTSKGRPLVPTPQHTPLFSFLTASPALDTLFVVSTVIHTLSFLCIGAMATHLCGGWSRRGRRTHPSVRYVCLPSERG

Predicted Molecular Mass
28.8 kDa
Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

glycoprotein G/gG Protein, HHV-1 (Cell-Free, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
glycoprotein G/gG Protein, HHV-1 (Cell-Free, His)
Cat. No.:
HY-P702297
Quantity:
MCE Japan Authorized Agent: