1. Recombinant Proteins
  2. Receptor Proteins
  3. G-Protein-Coupled Receptors (GPCRs)
  4. Glucagon Receptor
  5. GLP-1 Receptor
  6. GLP1R Protein, Mouse (His-SUMO)

GLP1R protein, a G-protein coupled receptor, binds to GLP-1, activating adenylyl cyclase and increasing intracellular cAMP levels. This interaction regulates insulin secretion and maintains glucose homeostasis. GLP1R can also form dimers with GIPR, suggesting complex regulatory mechanisms and interactions with other receptors. GLP1R Protein, Mouse (His-SUMO) is the recombinant mouse-derived GLP1R protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

GLP1R protein, a G-protein coupled receptor, binds to GLP-1, activating adenylyl cyclase and increasing intracellular cAMP levels. This interaction regulates insulin secretion and maintains glucose homeostasis. GLP1R can also form dimers with GIPR, suggesting complex regulatory mechanisms and interactions with other receptors. GLP1R Protein, Mouse (His-SUMO) is the recombinant mouse-derived GLP1R protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Background

GLP1R, a G-protein coupled receptor, specifically binds to glucagon-like peptide 1 (GLP-1), initiating a signaling cascade that activates adenylyl cyclase, leading to elevated intracellular cAMP levels. This molecular interaction plays a pivotal role in the regulation of insulin secretion in response to GLP-1, contributing to glucose homeostasis. Furthermore, GLP1R exhibits the potential to form homodimers and heterodimers with the GIPR receptor, indicating possible complexities in its regulatory mechanisms and interplay with other receptors within the cellular context.

Species

Mouse

Source

E. coli

Tag

N-6*His;N-SUMO

Accession

O35659 (G22-Y145)

Gene ID
Molecular Construction
N-term
6*His-SUMO
GLP1R (G22-Y145)
Accession # O35659
C-term
Protein Length

Partial

Synonyms
Glp1r; Glucagon-like peptide 1 receptor; GLP-1 receptor; GLP-1-R; GLP-1R
AA Sequence

GPRPQGTTVSLSETVQKWREYRRQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGLWLHKDNSSLPWRDLSECEESKRGERNFPEEQLLSLY

Molecular Weight

Approximately 30.4 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

GLP1R Protein, Mouse (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GLP1R Protein, Mouse (His-SUMO)
Cat. No.:
HY-P72206
Quantity:
MCE Japan Authorized Agent: