1. Recombinant Proteins
  2. Cytokines and Growth Factors Immune Checkpoint Proteins CD Antigens
  3. TNF Superfamily Stimulatory Immune Checkpoint Molecules Macrophage CD Proteins Monocyte CD Proteins
  4. TNF Receptor Superfamily GITR/CD357
  5. GITR/CD357
  6. GITR Protein, Canine (HEK293, His)

GITR is a type I transmembrane protein. GITR mediates signal transduction through NF-kB and MAPK pathways. Protects T cells from cell death induced by TCR activation. GITR inhibits proliferation and induces apoptosis of Multiple Myeloma (MM) cells in vitro and in vivo. GITR Protein, Canine (HEK293, His) is the recombinant canine-derived GITR protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

GITR is a type I transmembrane protein. GITR mediates signal transduction through NF-kB and MAPK pathways. Protects T cells from cell death induced by TCR activation. GITR inhibits proliferation and induces apoptosis of Multiple Myeloma (MM) cells in vitro and in vivo. GITR Protein, Canine (HEK293, His) is the recombinant canine-derived GITR protein, expressed by HEK293 , with C-6*His labeled tag.

Background

GITR (Glucocorticoid-induced TNFR-related protein, also known as TNFRSF18) is a type I transmembrane protein. GITR stimulates T lymphocyte proliferation and partially reverses the immunosuppressive function of CD4+CD25+ treg. GITR is expressed on regulatory T cells (Tregs) and some activated immune cells, including effector T lymphocytes, natural killer (NK) cells, and neutrophils. The amino acid sequence of human GITR protein has low homology with that of mouse GITR protein. GITR does not have any enzymatic activity, and the signal is propagated by recruiting members of the TRAF1 family, specifically TRAF1, TRAF2, and TRAF5, into the GITR signaling complex. Signal transduction is then mediated through the NF-kB and MAPK pathways. Protects T cells from cell death induced by TCR activation. GITR is activated by its ligand GITRL (TNFSF18). The NOS induction effect of GITR on mouse macrophages was time-dependent and dose-dependent. GITR inhibits proliferation and induces apoptosis of Multiple Myeloma (MM) cells in vitro and in vivo[1][2][3][4].

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Canine GITR at 2 μg/mL (100 μL/well) can bind Biotinylated Human GITR Ligand. The ED50 for this effect is 73.67 ng/mL, corresponding to a specific activity is 1.36×10^4 Unit/mg.

  • Measured by its binding ability in a functional ELISA. Immobilized Canine GITR at 2 μg/mL (100 μL/well) can bind Biotinylated Human GITR Ligand. The ED50 for this effect is 73.67 ng/mL, corresponding to a specific activity is 1.36×104 Unit/mg.
Species

Canine

Source

HEK293

Tag

C-6*His

Accession

D7F619 (G23-P154)

Gene ID
Molecular Construction
N-term
GITR (G23-P154)
Accession # D7F619
6*His
C-term
Protein Length

Partial

Synonyms
AITR; GITR; TNFRSF18; CD357
AA Sequence

GAPSCGPGRLLRGTGTDARCCRPCAPGEAAEKVCPELDCTCVQPGFHCGDPQCKTCKHHTCPPGQEVRPHGNFNFGFECVDCAAGTFSGGQEGRCKPWSDCSQFGYPTTFPGNKTHNAVCSPGLPPTEPRDP

Molecular Weight

19-25 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

GITR Protein, Canine (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GITR Protein, Canine (HEK293, His)
Cat. No.:
HY-P78640
Quantity:
MCE Japan Authorized Agent: