1. Recombinant Proteins
  2. Receptor Proteins
  3. GIPR Protein, Human (HEK293, His)

GIPR protein, a receptor for glucose-dependent insulinotropic polypeptide (GIP), operates through G proteins that activate adenylyl cyclase. Its capacity for homodimer and heterodimer formation with GLP1R implies potential interactions between receptors linked to incretin hormones. GIPR Protein, Human (HEK293, His) is the recombinant human-derived GIPR, expressed by HEK293, with C-10*His labeled tag. The total length of GIPR Protein, Human (HEK293, His) is 117 a.a..

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

GIPR protein, a receptor for glucose-dependent insulinotropic polypeptide (GIP), operates through G proteins that activate adenylyl cyclase. Its capacity for homodimer and heterodimer formation with GLP1R implies potential interactions between receptors linked to incretin hormones. GIPR Protein, Human (HEK293, His) is the recombinant human-derived GIPR, expressed by HEK293, with C-10*His labeled tag. The total length of GIPR Protein, Human (HEK293, His) is 117 a.a..

Background

The GIPR protein functions as a receptor for glucose-dependent insulinotropic polypeptide (GIP). Its activity is mediated by G proteins, specifically those that activate adenylyl cyclase. Notably, GIPR has the potential to form homodimers and heterodimers with GLP1R, suggesting a possible interaction between receptors associated with incretin hormones.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Human GIPR at 2 μg/mL can bind Anti-GIPR recombinant antibody. The ED50 is 19.68 ng/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized Human GIPR Protein, at 2 μg/mL (100μL/well) can bind Anti-GIPR antibody. The ED50 for this effect is 19.68 ng/mL.
Species

Human

Source

HEK293

Tag

C-10*His

Accession

P48546-1 (R22-Q138)

Gene ID

2696

Protein Length

Extracellular Domain

Synonyms
Gastric inhibitory polypeptide receptor; Glucose-dependent insulinotropic polypeptide receptor
AA Sequence

RAETGSKGQTAGELYQRWERYRRECQETLAAAEPPSGLACNGSFDMYVCWDYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCENPEKNEAFLDQRLILERLQ

Molecular Weight

Approximately 22-28 kDa due to the glycosylation.

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

GIPR Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GIPR Protein, Human (HEK293, His)
Cat. No.:
HY-P702800
Quantity:
MCE Japan Authorized Agent: