GGACT Protein, Human (HEK293, His)

The GGACT protein uses its enzymatic activity to break cross-links between lysine and glutamate residues, actively promoting the degradation of proteins cross-linked by transglutaminase. In addition, GGACT catalyzes the formation of 5-oxo-L-proline from the substrate L-γ-glutamyl-L-ε-lysine. GGACT Protein, Human (HEK293, His) is the recombinant human-derived GGACT protein, expressed by HEK293 , with N-6*His labeled tag.

GGACT (Gamma-glutamylamine cyclotransferase), also known as 5-oxoprolinase, plays a crucial role in the degradation of proteins cross-linked by transglutaminases by cleaving the cross-link between a lysine and a glutamic acid residue. Additionally, GGACT catalyzes the formation of 5-oxo-L-proline from L-gamma-glutamyl-L-epsilon-lysine. Notably, GGACT exhibits inactivity with substrates such as L-gamma-glutamyl-L-alpha-cysteine and L-gamma-glutamyl-L-alpha-alanine, suggesting substrate specificity in its enzymatic activity. The enzyme's ability to target specific cross-linked protein structures highlights its importance in cellular processes associated with protein turnover and degradation.

Human

HEK293

N-6*His

Q9BVM4 (M1-R153)

87769  [NCBI]

Full Length

MALVFVYGTLKRGQPNHRVLRDGAHGSAAFRARGRTLEPYPLVIAGEHNIPWLLHLPGSGRLVEGEVYAVDERMLRFLDDFESCPALYQRTVLRVQLLEDRAPGAEEPPAPTAVQCFVYSRATFPPEWAQLPHHDSYDSEGPHGLRYNPRENR

Approximately 18 kDa,based on SDS-PAGE under reducing conditions.

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.