1. Recombinant Proteins
  2. Others
  3. GDI2 Protein, Human (P.pastoris, His)

GDI2 protein inhibits the exchange of GDP to GTP in Rab proteins and regulates intracellular membrane transport. GDI2 Protein, Human (P.pastoris, His) is the recombinant human-derived GDI2 protein, expressed by P. pastoris , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

GDI2 protein inhibits the exchange of GDP to GTP in Rab proteins and regulates intracellular membrane transport. GDI2 Protein, Human (P.pastoris, His) is the recombinant human-derived GDI2 protein, expressed by P. pastoris , with N-His labeled tag.

Background

The GDI2 Protein acts as a GDP-dissociation inhibitor, preventing the exchange of GDP to GTP for most Rab proteins and thereby regulating intracellular membrane trafficking. By maintaining these small GTPases in their inactive GDP-bound form, GDI2 plays a crucial role in modulating cellular processes. It serves as a negative regulator of protein transport to the cilium and ciliogenesis by inhibiting RAB8A. GDI2 interacts with RHOH and the GDP-bound forms of various Rab proteins, including RAB3A, RAB3B, RAB3C, RAB5A, RAB5B, RAB5C, RAB8B, RAB10, RAB12, RAB35, and RAB43, with a lesser extent of binding to RAB3D. Furthermore, it interacts specifically with the GDP-bound inactive form of RAB8A, preventing its activation. The protein also interacts with DZIP1, negatively regulating the interaction between GDI2 and GDP-bound RAB8A. These interactions highlight the intricate regulatory role of GDI2 in governing membrane trafficking and cellular transport processes.

Species

Human

Source

P. pastoris

Tag

N-His

Accession

P50395 (M1-D445)

Gene ID
Molecular Construction
N-term
His
GDI2 (M1-D445)
Accession # P50395
C-term
Protein Length

Full Length

Synonyms
GDI-2; GDP dissociation inhibitor 2; Guanosine diphosphate dissociation inhibitor 2; Rab GDI beta; RABGDIB
AA Sequence

MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESASITPLEDLYKRFKIPGSPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVTEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRFRKFLVYVANFDEKDPRTFEGIDPKKTTMRDVYKKFDLGQDVIDFTGHALALYRTDDYLDQPCYETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIIVQNGKVIGVKSEGEIARCKQLICDPSYVKDRVEKVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISFAHNVAAQGKYIAIVSTTVETKEPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTESQIFISRTYDATTHFETTCDDIKNIYKRMTGSEFDFEEMKRKKNDIYGED

Predicted Molecular Mass
52.7 kDa
Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

GDI2 Protein, Human (P.pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GDI2 Protein, Human (P.pastoris, His)
Cat. No.:
HY-P71737
Quantity:
MCE Japan Authorized Agent: