1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TGF-beta Superfamily Neurotrophic Factors
  4. Growth Differentiation Factor GDNF family
  5. Growth Differentiation Factor 15 (GDF-15)
  6. GDF-15 Protein, Mouse (His)

The GDF-15 protein regulates food intake, energy balance, and body weight by binding to its receptor GFRAL. This activates GFRAL-expressing neurons in the brainstem, triggering "emergency circuits" in the central parabrachial nucleus and amygdala during stress. GDF-15 Protein, Mouse (His) is the recombinant mouse-derived GDF-15 protein, expressed by E. coli, with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The GDF-15 protein regulates food intake, energy balance, and body weight by binding to its receptor GFRAL. This activates GFRAL-expressing neurons in the brainstem, triggering "emergency circuits" in the central parabrachial nucleus and amygdala during stress. GDF-15 Protein, Mouse (His) is the recombinant mouse-derived GDF-15 protein, expressed by E. coli, with N-His labeled tag.

Background

GDF-15 Protein plays a crucial role in regulating food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stresses. It accomplishes this by binding to its receptor, GFRAL, and activating GFRAL-expressing neurons located in the area postrema and nucleus tractus solitarius of the brainstem. This activation subsequently triggers the activation of neurons within the parabrachial nucleus and central amygdala, which are part of the 'emergency circuit' responsible for shaping feeding responses in stressful conditions. Additionally, GDF-15 Protein inhibits growth hormone signaling on hepatocytes and forms a homodimer that is disulfide-linked. It also interacts with GFRAL, acting as a ligand to facilitate GDF15 internalization and cellular signaling through its interaction with RET.

Species

Mouse

Source

E. coli

Tag

N-His

Accession

Q9Z0J7 (S189-A303)

Gene ID

23886

Molecular Construction
N-term
His
GDF-15 (S189-A303)
Accession # Q9Z0J7
C-term
Synonyms
GDF-15; MIC-1; NAG-1; PDF; PLAB; PTGFB; GDF15; MIC1; RG-1; Placental TGF-beta; PTGF-beta; PTGFBPTGF-beta
AA Sequence

SAHAHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHAQIKARLHGLQPDKVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVARGCHCA

Predicted Molecular Mass
14.6 kDa.
Molecular Weight

Approximately 16-17 kDa, based on SDS-PAGE under reducing conditions.

Structure/Form
Monomer
Purity

Greater than 90% as determined by Tris-Bis PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GDF-15 Protein, Mouse (His)
Cat. No.:
HY-P703935
Quantity:
MCE Japan Authorized Agent: