1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TGF-beta Superfamily
  4. Bone Morphogenetic Proteins (BMPs)
  5. BMP-11/GDF-11
  6. GDF-11/BMP-11 Protein, Human (HEK293, solution)

GDF-11/BMP-11 Protein, Human (HEK293, solution)

Cat. No.: HY-P70222Y
Handling Instructions Technical Support

The GDF-11/BMP-11 protein is a secreted signaling protein that globally regulates anterior/posterior axis patterning during development and plays a key role in mesoderm and neural tissue patterning. GDF-11/BMP-11 is critical for vertebral and orofacial development and signals through type 2 activin receptors (ACVR2A and ACVR2B) and type 1 activin receptors (ACVR1B, ACVR1C and TGFBR1), leading to SMAD2 and SMAD3 phosphorylation. GDF-11/BMP-11 Protein, Human (HEK293, solution) is the recombinant human-derived GDF-11/BMP-11 protein, expressed by HEK293 , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The GDF-11/BMP-11 protein is a secreted signaling protein that globally regulates anterior/posterior axis patterning during development and plays a key role in mesoderm and neural tissue patterning. GDF-11/BMP-11 is critical for vertebral and orofacial development and signals through type 2 activin receptors (ACVR2A and ACVR2B) and type 1 activin receptors (ACVR1B, ACVR1C and TGFBR1), leading to SMAD2 and SMAD3 phosphorylation. GDF-11/BMP-11 Protein, Human (HEK293, solution) is the recombinant human-derived GDF-11/BMP-11 protein, expressed by HEK293 , with tag free.

Background

GDF-11/BMP-11 is a secreted signaling protein with a global regulatory impact on anterior/posterior axial patterning during development and is implicated in critical roles in mesodermal and neural tissue patterning. Essential for proper vertebral and orofacial development, GDF-11/BMP-11 transmits signals through activin receptors type-2 (ACVR2A and ACVR2B) and activin receptors type-1 (ACVR1B, ACVR1C, and TGFBR1), leading to the phosphorylation of SMAD2 and SMAD3. The protein forms homodimers through disulfide linkages and interacts directly with ACVR2A, ACVR2B, ACVR1B, TGFBR1, and ACVR1C, the latter in an ACVR2B-dependent manner. Additionally, GDF-11/BMP-11 engages with FST isoform 2/FS-288, highlighting its intricate interactions with key receptors in the signaling pathway.

In Vitro

GDF-11/BMP-11 (5, 10, 20, and 40 ng/mL; 7 d) maintains the colony and cellular morphology of undifferentiated human embryonic stem cells (hESC), maintains POU5f1, NANOG, TRA-1-60, and SSEA4 expression, and displays increased SMAD2/3 phosphorylation in serum-free medium at 20 ng/mL concentration[4].
GDF-11/BMP-11 (50-400 ng/mL; 2 d) induces browning of 3T3-L1 adipocytes via coordination of multiple signalling pathways, including mTORC1-COX2 and p38MAPK-PGC-1α as non-canonical pathways, as well as Smad1/5/8 as a canonical pathway[5].

Species

Human

Source

HEK293

Tag

Tag Free

Accession

O95390 (N299-S407)

Gene ID
Molecular Construction
N-term
BMP-11 (N299-S407)
Accession # O95390
C-term
Protein Length

Full Length of Mature Protein

Synonyms
rHuGrowth/differentiation factor 11; Growth/differentiation factor 11; GDF-11; Bone morphogenetic protein 11; BMP-11
AA Sequence

NLGLDCDEHSSESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQQANPRGSAGPCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS

Molecular Weight

Approximately 13.0-20 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 50% glycerol, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

GDF-11/BMP-11 Protein, Human (HEK293, solution) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GDF-11/BMP-11 Protein, Human (HEK293, solution)
Cat. No.:
HY-P70222Y
Quantity:
MCE Japan Authorized Agent: