1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. GALNT2 Protein, Human (HEK293, His)

The GALNT2 protein catalyzes the initial steps in O-linked oligosaccharide biosynthesis by transferring N-acetyl-D-galactosamine to a protein receptor. GALNT2 Protein, Human (HEK293, His) is the recombinant human-derived GALNT2 protein, expressed by HEK293 , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The GALNT2 protein catalyzes the initial steps in O-linked oligosaccharide biosynthesis by transferring N-acetyl-D-galactosamine to a protein receptor. GALNT2 Protein, Human (HEK293, His) is the recombinant human-derived GALNT2 protein, expressed by HEK293 , with N-His labeled tag.

Background

GALNT2 protein serves as a key enzyme in O-linked oligosaccharide biosynthesis, initiating the process by transferring an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. This enzymatic activity exhibits a wide substrate spectrum, including peptides such as EA2, Muc5AC, Muc1a, and Muc1b. GALNT2 is implicated in the O-linked glycosylation of critical proteins, including the immunoglobulin A1 (IgA1) hinge region, APOC-III, ANGPTL3, and PLTP. Additionally, it plays a role in the regulation of high-density lipoprotein cholesterol (HDL-C) metabolism, contributing to the intricate processes governing lipid homeostasis.

Biological Activity

Measured by its ability to transfer GalNAc from UDP-GalNAc to EA2 that incubate at 37°C for 20 min. The specific activity is 379.51-404.75 pmol/min/μg.

Species

Human

Source

HEK293

Tag

N-10*His

Accession

Q10471-1/NP_004472.1 (K52-Q571)

Gene ID
Molecular Construction
N-term
His
GALNT2 (K52-Q571)
Accession # Q10471/NP_004472.1
C-term
Synonyms
Polypeptide N-acetylgalactosaminyltransferase 2; GalNAc-T2
AA Sequence

KKKDLHHSNGEEKAQSMETLPPGKVRWPDFNQEAYVGGTMVRSGQDPYARNKFNQVESDKLRMDRAIPDTRHDQCQRKQWRVDLPATSVVITFHNEARSALLRTVVSVLKKSPPHLIKEIILVDDYSNDPEDGALLGKIEKVRVLRNDRREGLMRSRVRGADAAQAKVLTFLDSHCECNEHWLEPLLERVAEDRTRVVSPIIDVINMDNFQYVGASADLKGGFDWNLVFKWDYMTPEQRRSRQGNPVAPIKTPMIAGGLFVMDKFYFEELGKYDMMMDVWGGENLEISFRVWQCGGSLEIIPCSRVGHVFRKQHPYTFPGGSGTVFARNTRRAAEVWMDEYKNFYYAAVPSARNVPYGNIQSRLELRKKLSCKPFKWYLENVYPELRVPDHQDIAFGALQQGTNCLDTLGHFADGVVGVYECHNAGGNQEWALTKEKSVKHMDLCLTVVDRAPGSLIKLQGCRENDSRQKWEQIEGNSKLRHVGSNLCLDSRTAKSGGLSVEVCGPALSQQWKFTLNLQQ

Molecular Weight

Approximately 63 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 25 mM Tris, 150 mM NaCl, pH 7.5 or 25 mM Tris-HCL, 150 mM NaCl, pH 7.5, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

GALNT2 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GALNT2 Protein, Human (HEK293, His)
Cat. No.:
HY-P76355
Quantity:
MCE Japan Authorized Agent: