1. Recombinant Proteins
  2. Others
  3. Galectin-3/LGALS3 Protein, Human (HEK293, His)

Galectin-3/LGALS3 Protein, Human (HEK293, His)

Cat. No.: HY-P70171
Handling Instructions Technical Support

The Galectin-3/LGALS3 protein is a galactose-specific lectin known for its diverse roles in cellular processes. It binds IgE and synergizes with α-3 and β-1 integrins to promote CSPG4-induced endothelial cell migration. Galectin-3/LGALS3 Protein, Human (HEK293, His) is the recombinant human-derived Galectin-3/LGALS3 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample (5 μg)   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
250 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The Galectin-3/LGALS3 protein is a galactose-specific lectin known for its diverse roles in cellular processes. It binds IgE and synergizes with α-3 and β-1 integrins to promote CSPG4-induced endothelial cell migration. Galectin-3/LGALS3 Protein, Human (HEK293, His) is the recombinant human-derived Galectin-3/LGALS3 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

The Galectin-3/LGALS3 Protein is a galactose-specific lectin known for its versatile roles in cellular processes. It binds IgE and, in collaboration with the alpha-3, beta-1 integrin, facilitates CSPG4-induced migration of endothelial cells. Together with DMBT1, it is crucial for the terminal differentiation of columnar epithelial cells during early embryogenesis. In the nucleus, the protein serves as a pre-mRNA splicing factor and is actively involved in acute inflammatory responses, influencing neutrophil activation, adhesion, chemoattraction of monocytes and macrophages, opsonization of apoptotic neutrophils, and mast cell activation. Its partnership with TRIM16 allows for the coordinated recognition of membrane damage, triggering the mobilization of core autophagy regulators ATG16L1 and BECN1 in response to damaged endomembranes. The protein likely forms homo- or heterodimers and engages with various partners, including DMBT1, CD6, ALCAM, ITGA3, ITGB1, CSPG4, LGALS3BP, LYPD3, ZFTRAF1, UACA, TRIM16, and TMED10, facilitating diverse cellular interactions, including autophagy and secretion.

Biological Activity

1.Measured by the ability of the immobilized protein to support the adhesion of TF-1 Human blood leukemia cells. The ED50 this effect is ≤6.301 μg/ml, corresponding to a specific activity is ≥158.705 units/mg.
2.Measured by the ability of the immobilized protein to support the adhesion of MOLT-4. The ED50 for this effect is 2.117 μg/mL, corresponding to a specific activity is 472.367 units/mg.
3. Loaded Oloctinebart (HY-P990081) on AHC2 biosensor, can bind Galectin-3/LGALS3 Protein, Human (HEK293, His) with an affinity constant of 5.984E-08 M as determined in BLI assay.

  • Measured by the ability of the immobilized protein to support the adhesion of TF-1 Human blood leukemia cells. The ED50 for this effect is 6.301 μg/ml, corresponding to a specific activity is 158.705 units/mg.
  • Loaded Oloctinebart (HY-P990081) on AHC2 biosensor, can bind Galectin-3/LGALS3 Protein, Human (HEK293, His) with an affinity constant of 5.984E-08 M as determined in BLI assay.
Species

Human

Source

HEK293

Tag

C-6*His

Accession

AAH53667.1 (A2-I250)

Gene ID
Molecular Construction
N-term
LGALS3 (A2-I250)
Accession # AAH53667.1
6*His
C-term
Synonyms
rHuGalectin-3/LGALS3, His; Galectin-3; Gal-3; 35 kDa Lectin; Carbohydrate-Binding Protein 35; CBP 35; Galactose-Specific Lectin 3; Galactoside-Binding Protein; GALBP; IgE-Binding Protein; L-31; Laminin-Binding Protein; Lectin L-29; Mac-2 Antigen; LGALS3; MAC2
AA Sequence

ADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYHGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSAPGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI

Molecular Weight

Approximately 32-40 kDa due to the glycosylation.

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, 3 mM DTT, pH 7.4 or PBS, pH 7.4, 3 mM DTT, 5% trehalose, 5% mannitol and 0.01% Tween80 or PBS, pH 7.4, 3 mM DTT, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Galectin-3/LGALS3 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Galectin-3/LGALS3 Protein, Human (HEK293, His)
Cat. No.:
HY-P70171
Quantity:
MCE Japan Authorized Agent: