1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. Galactokinase/GALK1 Protein, Human (His)

Galactokinase (GALK1) protein facilitates the transfer of a phosphate group from ATP to alpha-D-galactose, playing a pivotal role in the initial and committed step of galactose catabolism. Through this enzymatic activity, GALK1 initiates the metabolic pathway responsible for breaking down galactose, contributing to its utilization within cellular processes. Galactokinase/GALK1 Protein, Human (His) is the recombinant human-derived Galactokinase/GALK1 protein, expressed by E. coli , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE Galactokinase/GALK1 Protein, Human (His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Galactokinase (GALK1) protein facilitates the transfer of a phosphate group from ATP to alpha-D-galactose, playing a pivotal role in the initial and committed step of galactose catabolism. Through this enzymatic activity, GALK1 initiates the metabolic pathway responsible for breaking down galactose, contributing to its utilization within cellular processes. Galactokinase/GALK1 Protein, Human (His) is the recombinant human-derived Galactokinase/GALK1 protein, expressed by E. coli , with C-6*His labeled tag.

Background

Galactokinase (GALK1) is an enzyme that plays a pivotal role in the catabolism of galactose by catalyzing the transfer of a phosphate group from ATP to alpha-D-galactose. This enzymatic activity represents the first committed step in the metabolic pathway of galactose, initiating its conversion into downstream metabolites. The phosphorylation of galactose by GALK1 is a crucial step in galactose utilization and allows for subsequent enzymatic reactions leading to the incorporation of galactose-derived metabolites into various cellular processes. Understanding the functions of GALK1 provides insights into the regulation of galactose metabolism and its importance in cellular energy production and the synthesis of glycoconjugates.

Species

Human

Source

E. coli

Tag

C-6*His

Accession

P51570 (M1-L392)

Gene ID
Molecular Construction
N-term
GALK1 (M1-L392)
Accession # P51570
6*His
C-term
Protein Length

Full Length

Synonyms
rHuGalactokinase/GALK1, His; Galactokinase; Galactose Kinase; GALK1; GALK
AA Sequence

MAALRQPQVAELLAEARRAFREEFGAEPELAVSAPGRVNLIGEHTDYNQGLVLPMALELMTVLVGSPRKDGLVSLLTTSEGADEPQRLQFPLPTAQRSLEPGTPRWANYVKGVIQYYPAAPLPGFSAVVVSSVPLGGGLSSSASLEVATYTFLQQLCPDSGTIAARAQVCQQAEHSFAGMPCGIMDQFISLMGQKGHALLIDCRSLETSLVPLSDPKLAVLITNSNVRHSLASSEYPVRRRQCEEVARALGKESLREVQLEELEAARDLVSKEGFRRARHVVGEIRRTAQAAAALRRGDYRAFGRLMVESHRSLRDDYEVSCPELDQLVEAALAVPGVYGSRMTGGGFGGCTVTLLEASAAPHAMRHIQEHYGGTATFYLSQAADGAKVLCL

Molecular Weight

Approximately 47.0 kDa

Purity

Greater than 85% as determined by reducing SDS-PAGE.

Appearance

Solution

Formulation

Supplied as a 0.2 μm filtered solution of 20mM Tris-HCl, 15% Trehalose, 10% Glycerol, 0.1% Tween80, 1mM TCEP, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

Galactokinase/GALK1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Galactokinase/GALK1 Protein, Human (His)
Cat. No.:
HY-P70365
Quantity:
MCE Japan Authorized Agent: