GADD45G/DDIT2 Protein, Human (His)

GADD45G/DDIT2 protein is a key mediator that regulates growth and apoptosis through the MTK1/MEKK4 MAPKKK signaling pathway. Concentration-dependent homodimerization enhances its growth inhibitory activity and interaction with PCNA, suggesting a role in DNA repair. GADD45G/DDIT2 Protein, Human (His) is the recombinant human-derived GADD45G/DDIT2 protein, expressed by E. coli , with N-6*His labeled tag.

The GADD45G/DDIT2 Protein plays a pivotal role in the regulation of both growth and apoptosis, acting as a mediator in the activation of the stress-responsive MTK1/MEKK4 MAPKKK signaling pathway. The protein undergoes concentration-dependent homodimerization, a crucial aspect for its growth inhibitory activity, and this homodimerization enhances its interaction with PCNA. GADD45G/DDIT2 further interacts with GADD45GIP1, forming a molecular complex that likely contributes to the modulation of cellular responses, particularly under stress conditions. Additionally, its interaction with PCNA suggests a role in DNA repair processes, highlighting the multifaceted functions of GADD45G/DDIT2 in coordinating cellular responses to stress and influencing essential pathways that govern growth and apoptosis.

Human

E. coli

N-6*His

O95257 (M1-E159)

10912  [NCBI]

MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE

Approximately 21.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.