1. Recombinant Proteins
  2. Others
  3. GADD45A/DDIT-1 Protein, Human (His)

GADD45A/DDIT-1 protein regulates p38 MAPK by inhibiting p88 phosphorylation in T cells, thereby affecting cell signaling pathways. It can regulate the PCNA-CDK complex, promote DNA excision repair, and hinder S phase entry. GADD45A/DDIT-1 Protein, Human (His) is the recombinant human-derived GADD45A/DDIT-1 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

GADD45A/DDIT-1 protein regulates p38 MAPK by inhibiting p88 phosphorylation in T cells, thereby affecting cell signaling pathways. It can regulate the PCNA-CDK complex, promote DNA excision repair, and hinder S phase entry. GADD45A/DDIT-1 Protein, Human (His) is the recombinant human-derived GADD45A/DDIT-1 protein, expressed by E. coli , with N-6*His labeled tag.

Background

In T-cells, the GADD45A/DDIT-1 protein functions as a regulator of p38 MAPKs by inhibiting p88 phosphorylation and activity, demonstrating its role in modulating cellular signaling pathways. Additionally, GADD45A/DDIT-1 might influence the interaction between PCNA and certain CDK complexes, thereby stimulating DNA excision repair in vitro while inhibiting the entry of cells into the S phase of the cell cycle. The protein interacts with MAPK14, and its quaternary structure exhibits a dynamic range, predominantly existing as a monomer while forming dimers and other oligomers with increasing concentration. GADD45A/DDIT-1 engages in specific protein-protein interactions, including weak interaction with PCNA and interaction with GADD45GIP1. Furthermore, it interacts with AURKA, suggesting a potential role in competing with dimerization processes related to cell cycle regulation.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P24522 (M1-R165)

Gene ID
Molecular Construction
N-term
6*His
GADD45A (M1-R165)
Accession # P24522
C-term
Protein Length

Full Length

Synonyms
rHuGrowth arrest and DNA damage-inducible protein GADD45 alpha/GADD45A, His; Growth Arrest and DNA Damage-Inducible Protein GADD45 Alpha; DNA Damage-Inducible Transcript 1 Protein; DDIT-1; GADD45A; DDIT1; GADD45
AA Sequence

MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLAADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER

Predicted Molecular Mass
20.5 kDa
Molecular Weight

Approximately 18 kDa,based on SDS-PAGE under reducing conditions.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

GADD45A/DDIT-1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GADD45A/DDIT-1 Protein, Human (His)
Cat. No.:
HY-P70326
Quantity:
MCE Japan Authorized Agent: