1. Recombinant Proteins
  2. Receptor Proteins
  3. GABRB2 Protein, Human (His)

GABRB2 protein is an important component of heteropentameric GABA receptors that form ligand-gated chloride channels. It plays a crucial role in establishing functional inhibitory GABAergic synapses, contributing to synaptic depression. GABRB2 Protein, Human (His) is the recombinant human-derived GABRB2 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

GABRB2 protein is an important component of heteropentameric GABA receptors that form ligand-gated chloride channels. It plays a crucial role in establishing functional inhibitory GABAergic synapses, contributing to synaptic depression. GABRB2 Protein, Human (His) is the recombinant human-derived GABRB2 protein, expressed by E. coli , with N-His labeled tag.

Background

The GABRB2 protein serves as a critical component of the heteropentameric receptor for gamma-aminobutyric acid (GABA), the principal inhibitory neurotransmitter in the brain. Functioning as a ligand-gated chloride channel, GABRB2 plays a vital role in the establishment of functional inhibitory GABAergic synapses, contributing to synaptic inhibition as a GABA-gated ion channel. The gamma2 subunit is essential for the rapid formation of active synaptic contacts, with the synaptogenic effect influenced by the specific combination of alpha and beta subunits in the receptor pentamer. Both the alpha1/beta2/gamma2 and alpha2/beta2/gamma2 receptor configurations exhibit synaptogenic activity. Beyond its role in GABA signaling, GABRB2 functions as a histamine receptor, mediating cellular responses to histamine. Moreover, the protein is allosterically activated by benzodiazepines and the anesthetic etomidate, while its activity is inhibited by the antagonist bicuculline.

Species

Human

Source

E. coli

Tag

N-His

Accession

P47870-1 (S26-Y244)

Gene ID
Molecular Construction
N-term
His
GABRB2 (S26-Y244)
Accession # P47870-1
C-term
Protein Length

Partial

Synonyms
GABA(A) receptor subunit beta-2
AA Sequence

SVNDPSNMSLVKETVDRLLKGYDIRLRPDFGGPPVAVGMNIDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGDDNAVTGVTKIELPQFSIVDYKLITKKVVFSTGSYPRLSLSFKLKRNIGY

Molecular Weight

Approximately 36 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized after extensive dialysis against solution in PBS, 6% Trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

GABRB2 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GABRB2 Protein, Human (His)
Cat. No.:
HY-P71447
Quantity:
MCE Japan Authorized Agent: