1. Recombinant Proteins
  2. Receptor Proteins
  3. GABARAPL1/GEC-1 Protein, Human (His)

GABARAPL1/GEC-1 is a multifunctional ubiquitin-like modifier that contributes to cell surface expression of kappa-type opioid receptors and contributes to autophagy, shaping autophagosome vacuoles.Unlike LC3, which is involved in phagophore elongation, the GABARAP/GATE-16 subfamily plays a crucial role in late autophagosome maturation.GABARAPL1/GEC-1 Protein, Human (His) is the recombinant human-derived GABARAPL1/GEC-1 protein, expressed by E.coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

GABARAPL1/GEC-1 is a multifunctional ubiquitin-like modifier that contributes to cell surface expression of kappa-type opioid receptors and contributes to autophagy, shaping autophagosome vacuoles.Unlike LC3, which is involved in phagophore elongation, the GABARAP/GATE-16 subfamily plays a crucial role in late autophagosome maturation.GABARAPL1/GEC-1 Protein, Human (His) is the recombinant human-derived GABARAPL1/GEC-1 protein, expressed by E.coli , with N-6*His labeled tag.

Background

GABARAPL1/GEC-1, a ubiquitin-like modifier, plays a multifaceted role in cellular processes. It enhances the cell-surface expression of kappa-type opioid receptors by facilitating their anterograde intracellular trafficking. Additionally, GABARAPL1/GEC-1 contributes to autophagy, participating in the formation of autophagosomal vacuoles. While LC3s are associated with phagophore membrane elongation, the GABARAP/GATE-16 subfamily assumes a crucial role in later stages of autophagosome maturation. Furthermore, GABARAPL1/GEC-1 collaborates with the reticulophagy receptor TEX264 to remodel subdomains of the endoplasmic reticulum into autophagosomes during nutrient stress, facilitating subsequent fusion with lysosomes for endoplasmic reticulum turnover. The protein engages in a network of interactions with various partners, including ATG13, OPRK1, RB1CC1, ULK1, TP53INP1, TP53INP2, SQSTM1, ATG3, ATG7, MAP15, TECPR2, TBC1D5, MAPK15, TRIM5, MEFV, TRIM21, WDFY3, UBA5, KBTBD6, KBTBD7, RETREG1, RETREG2, RETREG3, TEX264, and IRGM, underscoring its significance in cellular homeostasis and autophagic processes.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q9H0R8 (M1-K117)

Gene ID
Molecular Construction
N-term
6*His
GABARAPL1 (M1-K117)
Accession # Q9H0R8
C-term
Protein Length

Full Length

Synonyms
Gamma-Aminobutyric Acid Receptor-Associated Protein-Like 1; Early Estrogen-Regulated Protein; GABA(A) Receptor-Associated Protein-Like 1; Glandular Epithelial Cell Protein 1; GEC-1; GABARAPL1; GEC1
AA Sequence

MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK

Molecular Weight

Approximately 20.0 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

GABARAPL1/GEC-1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GABARAPL1/GEC-1 Protein, Human (His)
Cat. No.:
HY-P70913
Quantity:
MCE Japan Authorized Agent: