1. Recombinant Proteins
  2. Receptor Proteins
  3. GABARAP Protein, Human (His, Fc)

GABARAP (gamma-aminobutyric acid receptor-associated protein) is a protein that performs multiple functions within cells. As a ubiquitin-like modifier, it participates in the intracellular transport of GABA(A) receptors and interacts with the cytoskeleton. GABARAP Protein, Human (His, Fc) is the recombinant human-derived GABARAP protein, expressed by E. coli , with N-His, C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

GABARAP (gamma-aminobutyric acid receptor-associated protein) is a protein that performs multiple functions within cells. As a ubiquitin-like modifier, it participates in the intracellular transport of GABA(A) receptors and interacts with the cytoskeleton. GABARAP Protein, Human (His, Fc) is the recombinant human-derived GABARAP protein, expressed by E. coli , with N-His, C-hFc labeled tag.

Background

GABARAP (Gamma-aminobutyric acid receptor-associated protein) is a protein that serves multiple functions within the cell. It acts as a ubiquitin-like modifier, participating in the intracellular transport of GABA(A) receptors and interacting with the cytoskeleton. GABARAP is involved in autophagy, specifically in the later stages of autophagosome maturation. It interacts with the reticulophagy receptor TEX264 to remodel subdomains of the endoplasmic reticulum into autophagosomes, which then merge with lysosomes for turnover of the endoplasmic reticulum. GABARAP is also essential for the local activation of the CUL3(KBTBD6/7) E3 ubiquitin ligase complex, which regulates the ubiquitination and degradation of TIAM1, a guanyl-nucleotide exchange factor. This degradation of TIAM1 affects downstream signal transduction pathways involved in cell migration, proliferation, and cytoskeleton organization. Additionally, GABARAP has been implicated in apoptosis. Overall, GABARAP plays a vital role in various biological processes, including intracellular transport, autophagy, cytoskeleton organization, and cell signaling.

Species

Human

Source

E. coli

Tag

N-6*His;C-hFc

Accession

Q6IAW1 (M1-L117)

Gene ID
Molecular Construction
N-term
6*His
GABARAP (M1-L117)
Accession # Q6IAW1
hFc
C-term
Protein Length

Full Length

Synonyms
GABA(A) Receptor-Associated Protein; GABARAP Protein; HCG1987397 Isoform CRA_b; GABARAP
AA Sequence

MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL

Molecular Weight

Approximately 50 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM PB,150 mM NaCl, 20% glycerol, pH 7.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

GABARAP Protein, Human (His, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GABARAP Protein, Human (His, Fc)
Cat. No.:
HY-P72639
Quantity:
MCE Japan Authorized Agent: