1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. CSF & Receptors
  4. G-CSF
  5. G-CSF Protein, Mouse (HEK293, His)

The G-CSF Protein, a monomeric cytokine in the granulocyte/macrophage colony-stimulating factor family, crucially regulates hematopoiesis by orchestrating the production, differentiation, and function of granulocytes and monocytes-macrophages. Its production emphasizes its significance in maintaining immune system balance and functionality. G-CSF Protein, Mouse (HEK293, His) is the recombinant mouse-derived G-CSF protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample (2 μg)   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE G-CSF Protein, Mouse (HEK293, His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The G-CSF Protein, a monomeric cytokine in the granulocyte/macrophage colony-stimulating factor family, crucially regulates hematopoiesis by orchestrating the production, differentiation, and function of granulocytes and monocytes-macrophages. Its production emphasizes its significance in maintaining immune system balance and functionality. G-CSF Protein, Mouse (HEK293, His) is the recombinant mouse-derived G-CSF protein, expressed by HEK293 , with C-6*His labeled tag.

Background

The G-CSF Protein, a member of the granulocyte/macrophage colony-stimulating factors, plays a crucial role in hematopoiesis by regulating the production, differentiation, and function of two closely related white cell populations in the blood: granulocytes and monocytes-macrophages. Specifically, this cytokine induces the generation of granulocytes, contributing to the intricate orchestration of hematopoietic processes.

Biological Activity

Measured in a cell proliferation assay using NFS 60 mouse myelogenous leukemia lymphoblast cells. The ED50 for this effect is ≤103.9 pg/mL, corresponding to a specific activity is ≥6.9624×106 units/mg.

  • Measured in a cell proliferation assay using NFS 60 mouse myelogenous leukemia lymphoblast cells. The ED50 for this effect is 103.9 pg/mL, corresponding to a specific activity is 6.9624×106 units/mg.
Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

P09920 (V31-A208)

Gene ID
Molecular Construction
N-term
G-CSF (V31-A208)
Accession # P09920
6*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Granulocyte colony-stimulating factor; Csf3; G-CSF
AA Sequence

VPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAFQRRAGGVLAISYLQGFLETARLALHHLA

Molecular Weight

Approximately 22-30 kDa due to the glycosylation.

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 10 mM Sodium Citrate, 0.1% Tween 20, pH 3.5 or 20 mM PB, 150 mM NaCl, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween80 or PBS, pH 7.0, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

G-CSF Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
G-CSF Protein, Mouse (HEK293, His)
Cat. No.:
HY-P70554
Quantity:
MCE Japan Authorized Agent: