1. Recombinant Proteins
  2. Receptor Proteins
  3. G-Protein-Coupled Receptors (GPCRs)
  4. Frizzled
  5. Frizzled-6
  6. Frizzled-6 Protein, Human (HEK293, His)

Frizzled-6 is a Wnt receptor that complexly activates signaling pathways that converge primarily on the β-catenin canonical pathway. This triggers disorganized protein activation, GSK-3 kinase inhibition, nuclear β-catenin accumulation, and Wnt target gene activation. Frizzled-6 Protein, Human (HEK293, His) is the recombinant human-derived Frizzled-6 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Frizzled-6 is a Wnt receptor that complexly activates signaling pathways that converge primarily on the β-catenin canonical pathway. This triggers disorganized protein activation, GSK-3 kinase inhibition, nuclear β-catenin accumulation, and Wnt target gene activation. Frizzled-6 Protein, Human (HEK293, His) is the recombinant human-derived Frizzled-6 protein, expressed by HEK293 , with C-His labeled tag.

Background

Frizzled-6, a receptor for Wnt proteins, is intricately involved in signaling pathways that predominantly converge on the beta-catenin canonical pathway. This cascade triggers the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin, and subsequent activation of Wnt target genes. While a secondary signaling pathway implicating PKC and calcium fluxes has been observed in some family members, its precise relationship with the canonical pathway remains unclear, and the requirement of PKC for Wnt-mediated inactivation of GSK-3 kinase adds complexity to this interplay. Interactions with G-proteins are integral to both pathways. Frizzled-6 is positioned to play a pivotal role in transducing polarity information during tissue morphogenesis and in differentiated tissues. Teaming up with FZD3, it contributes to neural tube closure and regulates the establishment of planar cell polarity, especially in orienting asymmetric bundles of stereocilia on the apical faces of select auditory and vestibular sensory cells within the inner ear. Its functional repertoire is further underscored by interactions with LMBR1L.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Human Frizzled-6, at 0.1μg/mL (100 μL/well) can bind Wnt-5a. The ED50 for this effect is 125.3 ng/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized Human Frizzled-6, at 0.1 μg/mL (100 μL/well) can bind Wnt-5a. The ED50 for this effect is 125.3 ng/mL.
Species

Human

Source

HEK293

Tag

C-6*His

Accession

O60353-1/NP_003497.2 (H19-V153)

Gene ID
Molecular Construction
N-term
Frizzled-6 (H19-V153)
Accession # O60353/NP_003497.2
His
C-term
Protein Length

Partial

Synonyms
Frizzled homolog 6 (Drosophila); Frizzled-6; fz-6; FZD6
AA Sequence

HSLFTCEPITVPRCMKMAYNMTFFPNLMGHYDQSIAAVEMEHFLPLANLECSPNIETFLCKAFVPTCIEQIHVVPPCRKLCEKVYSDCKKLIDTFGIRWPEELECDRLQYCDETVPVTFDPHTEFLGPQKKTEQV

Molecular Weight

Approximately 20-28 kDa due to the glycosylation

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Frizzled-6 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Frizzled-6 Protein, Human (HEK293, His)
Cat. No.:
HY-P74134
Quantity:
MCE Japan Authorized Agent: