1. Recombinant Proteins
  2. CD Antigens Receptor Proteins
  3. Epithelial cell CD Proteins Endothelial cell CD Proteins G-Protein-Coupled Receptors (GPCRs)
  4. Frizzled-4/CD344 Frizzled
  5. Frizzled-4/CD344
  6. Frizzled-4/CD344 Protein, Human (HEK293, His)

The Frizzled-4/CD344 protein is a receptor for Wnt proteins and is associated with the classical β-catenin pathway, activating disheveled proteins, inhibiting GSK-3 kinase, and triggering Wnt target genes. In retinal vascularization, it acts as a receptor for Wnt proteins and Norrin (NDP), stimulating β-catenin accumulation and LEF/TCF-mediated transcription. Frizzled-4/CD344 Protein, Human (HEK293, His) is the recombinant human-derived Frizzled-4/CD344 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The Frizzled-4/CD344 protein is a receptor for Wnt proteins and is associated with the classical β-catenin pathway, activating disheveled proteins, inhibiting GSK-3 kinase, and triggering Wnt target genes. In retinal vascularization, it acts as a receptor for Wnt proteins and Norrin (NDP), stimulating β-catenin accumulation and LEF/TCF-mediated transcription. Frizzled-4/CD344 Protein, Human (HEK293, His) is the recombinant human-derived Frizzled-4/CD344 protein, expressed by HEK293 , with C-His labeled tag.

Background

Frizzled-4/CD344 Protein serves as a receptor for Wnt proteins, particularly associated with the canonical beta-catenin signaling pathway, involving the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin, and subsequent activation of Wnt target genes. In the context of retinal vascularization, Frizzled-4 plays a pivotal role by acting as a receptor for both Wnt proteins and norrin (NDP), facilitating beta-catenin accumulation and stimulation of LEF/TCF-mediated transcriptional programs. Although a secondary signaling pathway, featuring PKC and calcium fluxes, has been observed in some family members, its integration with the canonical pathway, particularly in the context of Wnt-mediated inactivation of GSK-3 kinase, remains uncertain. Frizzled-4's involvement in tissue morphogenesis and intercellular transmission of polarity information is suggested, with interactions observed with MAGI3, NDP, TSKU, and glypican GPC3, highlighting its intricate role in cellular processes and signaling cascades.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Human Frizzled-4, at 0.1 μg/mL (100 μL/well) can bind Wnt-5a. The ED50 for this effect is 26.59 ng/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized Human Frizzled-4, at 0.1 μg/mL (100 μL/well) can bind Wnt-5a. The ED50 for this effect is 26.59 ng/mL.
Species

Human

Source

HEK293

Tag

C-His

Accession

Q9ULV1 (F37-E180)

Gene ID
Molecular Construction
N-term
FZD4 (F37-E180)
Accession # Q9ULV1
His
C-term
Protein Length

Partial

Synonyms
CD344 antigen; CD344; EVR1; FEVR; Frizzled-4; Fz-4; FZD4
AA Sequence

FGDEEERRCDPIRISMCQNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEE

Molecular Weight

Approximately 22-25 kDa due to glycosylation

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Frizzled-4/CD344 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Frizzled-4/CD344 Protein, Human (HEK293, His)
Cat. No.:
HY-P74140
Quantity:
MCE Japan Authorized Agent: