1. Recombinant Proteins
  2. CD Antigens Receptor Proteins
  3. Epithelial cell CD Proteins G-Protein-Coupled Receptors (GPCRs)
  4. Frizzled-10/CD350 Frizzled
  5. Frizzled-10/CD350
  6. Frizzled-10/CD350 Protein, Human (HEK293, His)

The Frizzled-10/CD350 gene is a member of the Frizzled gene family, encoding a 7-transmembrane domain protein that acts as a receptor for the Wingless-type MMTV integration site family signaling protein. Most Frizzled receptors, including Frizzled-10/CD350, are involved in cell signaling, specifically the β-catenin classical pathway. Frizzled-10/CD350 Protein, Human (HEK293, His) is the recombinant human-derived Frizzled-10/CD350 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The Frizzled-10/CD350 gene is a member of the Frizzled gene family, encoding a 7-transmembrane domain protein that acts as a receptor for the Wingless-type MMTV integration site family signaling protein. Most Frizzled receptors, including Frizzled-10/CD350, are involved in cell signaling, specifically the β-catenin classical pathway. Frizzled-10/CD350 Protein, Human (HEK293, His) is the recombinant human-derived Frizzled-10/CD350 protein, expressed by HEK293 , with C-His labeled tag.

Background

The Frizzled-10/CD350 gene belongs to the frizzled gene family, encoding 7-transmembrane domain proteins serving as receptors for the Wingless type MMTV integration site family of signaling proteins. Typically associated with the beta-catenin canonical signaling pathway, most frizzled receptors play crucial roles in cellular signaling. Notably, through array analysis, expression of this intronless gene demonstrates a significant up-regulation in two instances of primary colon cancer. This suggests a potential involvement of Frizzled-10/CD350 in the context of colon cancer, prompting further exploration of its specific contributions to signaling pathways and cancer progression.

Biological Activity

Measured by its ability to bind biotinylated recombinant mouse Wnt-3a in a functional ELISA. The ED50 for this effect is 4.336 nM.

  • Measured by its ability to bind biotinylated recombinant mouse Wnt-3a in a functional ELISA. The ED50 for this effect is 4.336nM.
Species

Human

Source

HEK293

Tag

C-6*His

Accession

NP_009128.1 (I21-G161)

Gene ID
Molecular Construction
N-term
CD350 (I21-G161)
Accession # NP_009128.1
His
C-term
Protein Length

Partial

Synonyms
CD350; Frizzled homolog 10 (Drosophila); Frizzled-10; FZ-10
AA Sequence

ISSMDMERPGDGKCQPIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSPIMEQFNFKWPDSLDCRKLPNKNDPNYLCMEAPNNGSDEPTRG

Molecular Weight

Approximately 20-25 kDa due to the glycosylation.

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Frizzled-10/CD350 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Frizzled-10/CD350 Protein, Human (HEK293, His)
Cat. No.:
HY-P74146
Quantity:
MCE Japan Authorized Agent: