1. Recombinant Proteins
  2. Others
  3. Frataxin/FXN Protein, Human (His, Myc)

Frataxin/FXN protein activates the core iron-sulfur cluster assembly complex and accelerates sulfur transfer for [2Fe-2S] cluster assembly. It plays a key role in the de novo synthesis of clusters, delivering persulfide to the ISCU. Frataxin/FXN Protein, Human (His, Myc) is the recombinant human-derived Frataxin/FXN protein, expressed by E. coli , with C-Myc, N-10*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Frataxin/FXN protein activates the core iron-sulfur cluster assembly complex and accelerates sulfur transfer for [2Fe-2S] cluster assembly. It plays a key role in the de novo synthesis of clusters, delivering persulfide to the ISCU. Frataxin/FXN Protein, Human (His, Myc) is the recombinant human-derived Frataxin/FXN protein, expressed by E. coli , with C-Myc, N-10*His labeled tag.

Background

Frataxin/FXN protein serves as an activator within the core iron-sulfur cluster (ISC) assembly complex, facilitating persulfide transfer to the scaffolding protein ISCU and participating in [2Fe-2S] cluster assembly. It expedites sulfur transfer from the NFS1 persulfide intermediate to ISCU and small thiols like L-cysteine and glutathione, leading to persulfuration and sulfide release. Frataxin/FXN is integral to the de novo synthesis of a [2Fe-2S] cluster, initiated by the cysteine desulfurase complex (NFS1:LYRM4:NDUFAB1) producing persulfide, which is delivered to ISCU in a FXN-dependent manner. This complex is stabilized by FDX2, providing reducing equivalents for [2Fe-2S] cluster assembly. The cluster is subsequently transferred from ISCU to chaperone proteins, including HSCB, HSPA9, and GLRX5. Frataxin/FXN may play a role in protecting against iron-catalyzed oxidative stress through its ferroxidase activity, particularly in its oligomeric form. It might also function as an iron chaperone, safeguarding the aconitase [4Fe-4S]2+ cluster and promoting enzyme reactivation. Additionally, Frataxin/FXN may act as a high-affinity iron binding partner for FECH, contributing to mitochondrial heme biosynthesis, modulating the RNA-binding activity of ACO1, and potentially influencing cytoplasmic iron-sulfur protein biogenesis, overall impacting oxidative stress resistance and cell survival.

Species

Human

Source

E. coli

Tag

C-Myc;N-10*His

Accession

Q16595-1 (M1-A210)

Gene ID
Molecular Construction
N-term
10*His
Frataxin (M1-A210)
Accession # Q16595-1
C-term
Protein Length

Full Length of Isoform-1

Synonyms
CyaY; FRDA; X25
AA Sequence

MWTLGRRAVAGLLASPSPAQAQTLTRVPRPAELAPLCGRRGLRTDIDATCTPRRASSNQRGLNQIWNVKKQSVYLMNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDLSSLAYSGKDA

Molecular Weight

Approximately 33 kDa

Purity
  • Greater than 92% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from 0.22 μm filtered solution in PBS, 6% Trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Frataxin/FXN Protein, Human (His, Myc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Frataxin/FXN Protein, Human (His, Myc)
Cat. No.:
HY-P72266
Quantity:
MCE Japan Authorized Agent: