1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CX3CL1
  5. Fractalkine/CX3CL1 Protein, Human

Fractalkine/CX3CL1 Protein, Human is found to be associated with inflammatory diseases such as rheumatoid arthritis (RA), rheumatoid vasculitis (RV).

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg Get quote
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Fractalkine/CX3CL1 Protein, Human is found to be associated with inflammatory diseases such as rheumatoid arthritis (RA), rheumatoid vasculitis (RV).

Background

Fractalkine/CX3CL1 exists in two forms: as a membrane-anchored or as a shed 80-95K glycoprotein. Fractalkine/CX3CL1 is expressed in monocytes during inflammatory conditions. Fractalkine/CX3CL1 is also expressed in macrophages, fibroblasts, endothelial, and dendritic cells in rheumatoid arthritis (RA) synovial tissue. CX3CL1 is associated with the development of different diseases such as rheumatoid arthritis (RA), rheumatoid vasculitis (RV), Sjögren’s syndrome (SS), systemic lupus erythematosus (SLE), scleroderma, multiple sclerosis, and atherosclerosis[1].

Biological Activity

1.Full biological activity determined by a chemotaxis bioassay using human T-lymphocytes is in a concentration of 5.0-10 ng/mL.
2.Measured by its ability to chemoattract THP-1 cells. The ED50 for this effect is 7.841 ng/mL, corresponding to a specific activity is 1.275×105 U/mg.

  • Measured by its ability to chemoattract THP-1 cells. The ED50 for this effect is 7.841 ng/mL, corresponding to a specific activity is 1.275×105 U/mg.
Species

Human

Source

E. coli

Tag

Tag Free

Accession

P78423 (Q25-G100)

Gene ID
Molecular Construction
N-term
Fractalkine (Q25-G100)
Accession # P78423
C-term
Protein Length

Partial

Synonyms
rHuFractalkine/CX3CL1; Neurotactin; SCYD1; NTT
AA Sequence

QHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNG

Predicted Molecular Mass
8.6 kDa
Molecular Weight

Approximately 9 kDa, based on SDS-PAGE under reducing conditions.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 20 mM PB, pH 7.4, 50 mM NaCl or PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

Fractalkine/CX3CL1 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Fractalkine/CX3CL1 Protein, Human
Cat. No.:
HY-P7180
Quantity:
MCE Japan Authorized Agent: