1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Isomerases (EC 5)
  4. FNDC4 Protein, Human (HEK293, Fc)

The FNDC4 protein is an anti-inflammatory factor in the intestine and colon that regulates macrophages by downregulating pro-inflammatory gene expression and affecting phagocytosis. It does this by modulating key pathways associated with macrophage activation, in part through STAT3 activation and signaling. FNDC4 Protein, Human (HEK293, Fc) is the recombinant human-derived FNDC4 protein, expressed by HEK293 , with C-mFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The FNDC4 protein is an anti-inflammatory factor in the intestine and colon that regulates macrophages by downregulating pro-inflammatory gene expression and affecting phagocytosis. It does this by modulating key pathways associated with macrophage activation, in part through STAT3 activation and signaling. FNDC4 Protein, Human (HEK293, Fc) is the recombinant human-derived FNDC4 protein, expressed by HEK293 , with C-mFc labeled tag.

Background

FNDC4 protein functions as an anti-inflammatory factor in the intestine and colon, exerting its regulatory influence on macrophages. Through binding and interaction with macrophages, FNDC4 down-regulates the expression of pro-inflammatory genes, influencing essential macrophage functions such as phagocytosis. This anti-inflammatory effect is achieved by modulating key pathways associated with macrophage activation, in part through the activation and signaling of STAT3. The role of FNDC4 in dampening the immunological response, particularly in the context of colitis, underscores its potential significance as a molecular mediator in maintaining intestinal immune homeostasis.

Biological Activity

Measured in a cell proliferation assay using U87 cells. The ED50 for this effect is 63 ng/mL. Corresponding to a specific activity is 1.587×104 unit/mg.

  • Measured in a cell proliferation assay using U87 cells. The ED50 for this effect is 63 ng/mL. Corresponding to a specific activity is 1.587×104 Unit/mg.
Species

Human

Source

HEK293

Tag

C-mFc

Accession

Q9H6D8/NP_073734.1 (D45-T167)

Gene ID
Molecular Construction
N-term
FNDC4 (D45-T167)
Accession # Q9H6D8/NP_073734.1
mFc
C-term
Protein Length

Extracellular Domain

Synonyms
Fibronectin type III domain-containing protein 4; Fibronectin type III repeat-containing protein 1; FRCP1
AA Sequence

DRPPSPVNVTVTHLRANSATVSWDVPEGNIVIGYSISQQRQNGPGQRVIREVNTTTRACALWGLAEDSDYTVQVRSIGLRGESPPGPRVHFRTLKGSDRLPSNSSSPGDITVEGLDGERPLQT

Molecular Weight

Approximately 50-60 kDa due to the glycosylation

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

FNDC4 Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FNDC4 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P76935
Quantity:
MCE Japan Authorized Agent: