1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. FLT3LG Protein, Mouse (HEK293, His)

FLT3LG protein, a potent stimulator, activates FLT3, synergizing with colony-stimulating factors and interleukins. Its homodimeric form, especially in the soluble isoform, effectively promotes the expansion and differentiation of hematopoietic progenitor cells. The protein's significance lies in orchestrating key processes within the hematopoietic system. FLT3LG Protein, Mouse (HEK293, His) is the recombinant mouse-derived FLT3LG protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

FLT3LG protein, a potent stimulator, activates FLT3, synergizing with colony-stimulating factors and interleukins. Its homodimeric form, especially in the soluble isoform, effectively promotes the expansion and differentiation of hematopoietic progenitor cells. The protein's significance lies in orchestrating key processes within the hematopoietic system. FLT3LG Protein, Mouse (HEK293, His) is the recombinant mouse-derived FLT3LG protein, expressed by HEK293 , with C-6*His labeled tag.

Background

The FLT3LG protein acts as a potent stimulator, fostering the proliferation of early hematopoietic cells through the activation of FLT3. Exhibiting synergistic effects, particularly in its soluble isoform, this homodimeric protein collaborates effectively with various colony-stimulating factors and interleukins. Its role in promoting the expansion and differentiation of hematopoietic progenitor cells underscores its significance in orchestrating key processes within the hematopoietic system.

Biological Activity

1.Measured in a cell proliferation assay using K562 cells. The ED50 this effect is 4.628 ng/mL, corresponding to a specific activity is 2.1608×105 units/mg.
2.Measured in a cell proliferation assay using BaF3 mouse pro-B cells transfected with Flt-3. The ED50 for this effect is 1.240 ng/mL. Corresponding to a specific activity is 8.065×105 units/mg.
3. Mouse FLT3 immobilized on CM5 Chip can bind Mouse FLT3LG with an affinity constant of 0.9135 nM as determined in a SPR assay.

  • Measured in a cell proliferation assay using K562 cells. The ED50 this effect is 4.628 ng/mL, corresponding to a specific activity is 2.1608×105 units/mg.
Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

P49772-1 (G27-R188)

Gene ID
Molecular Construction
N-term
FLT3LG (G27-R188)
Accession # P49772-1
6*His
C-term
Protein Length

Extracellular Domain

Synonyms
Fms-related tyrosine kinase 3 ligand (Flt3L); SL cytokine; Flt3 ligand;
AA Sequence

GTPDCYFSHSPISSNFKVKFRELTDHLLKDYPVTVAVNLQDEKHCKALWSLFLAQRWIEQLKTVAGSKMQTLLEDVNTEIHFVTSCTFQPLPECLRFVQTNISHLLKDTCTQLLALKPCIGKACQNFSRCLEVQCQPDSSTLLPPRSPIALEATELPEPRPR

Predicted Molecular Mass
20.2 kDa
Molecular Weight

Approximately 22-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

FLT3LG Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FLT3LG Protein, Mouse (HEK293, His)
Cat. No.:
HY-P70563
Quantity:
MCE Japan Authorized Agent: