1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Isomerases (EC 5)
  4. FkpA Protein, E.coli (His-SUMO)

The FkpA protein plays a central role in cellular processes, acting as a key catalyst in the complex dance of protein folding. Its catalytic efficiency is excellent in promoting the cis-trans isomerization of proline-imine peptide bonds, thus accelerating the overall folding of proteins. FkpA Protein, E.coli (His-SUMO) ) is the recombinant E. coli-derived FkpA protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock
50 μg Ask For Quote & Lead Time

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The FkpA protein plays a central role in cellular processes, acting as a key catalyst in the complex dance of protein folding. Its catalytic efficiency is excellent in promoting the cis-trans isomerization of proline-imine peptide bonds, thus accelerating the overall folding of proteins. FkpA Protein, E.coli (His-SUMO) ) is the recombinant E. coli-derived FkpA protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Background

At the forefront of cellular machinery, the FkpA protein emerges as a key catalyst in expediting the intricate process of protein folding. Its catalytic prowess is particularly evident in the facilitation of cis-trans isomerization of proline imidic peptide bonds within oligopeptides. By orchestrating these precise structural changes, FkpA significantly accelerates the overall folding of proteins, unveiling its vital role in ensuring the timely and accurate formation of functional protein structures. This molecular finesse highlights FkpA's importance in the complex choreography of cellular processes, emphasizing its contribution to maintaining cellular homeostasis.

Species

E.coli

Source

E. coli

Tag

N-His;N-SUMO

Accession

P65764 (A26-K270)

Gene ID

75206290  [NCBI]

Molecular Construction
N-term
6*His-SUMO
FkpA (A26-K270)
Accession # P65764
C-term
Protein Length

Full Length of Mature Protein

Synonyms
fkpA; c4121FKBP-type peptidyl-prolyl cis-trans isomerase FkpA; PPIase; EC 5.2.1.8; Rotamase
AA Sequence

AEAAKPATTADSKAAFKNDDQKSAYALGASLGRYMENSLKEQEKLGIKLDKDQLIAGVQDAFADKSKLSDQEIEQTLQAFEARVKSSAQAKMEKDAADNEAKGKEYREKFAKEKGVKTSSTGLVYQVVEAGKGEAPKDSDTVVVNYKGTLIDGKEFDNSYTRGEPLSFRLDGVIPGWTEGLKNIKKGGKIKLVIPPELAYGKAGVPGIPPNSTLVFDVELLDVKPAPKADAKPEADAKAADSAKK

Molecular Weight

Approximately 48 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

FkpA Protein, E.coli (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FkpA Protein, E.coli (His-SUMO)
Cat. No.:
HY-P71477
Quantity:
MCE Japan Authorized Agent: