1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Isomerases (EC 5)
  4. FKBP3 Protein, Human (His)

FKBP3 is a member of the FK506 and rapamycin-binding protein (FKBP) family and serves as a receptor for the immunosuppressants FK506 and rapamycin, both of which inhibit two distinct cytoplasmic signaling pathways. T cell proliferation. In addition to serving as a receptor for these immunosuppressants, FKBP3, like other peptidyl prolyl cis-trans isomerases (PPIases), also functions to accelerate protein folding. FKBP3 Protein, Human (His) is the recombinant human-derived FKBP3 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

FKBP3 is a member of the FK506 and rapamycin-binding protein (FKBP) family and serves as a receptor for the immunosuppressants FK506 and rapamycin, both of which inhibit two distinct cytoplasmic signaling pathways. T cell proliferation. In addition to serving as a receptor for these immunosuppressants, FKBP3, like other peptidyl prolyl cis-trans isomerases (PPIases), also functions to accelerate protein folding. FKBP3 Protein, Human (His) is the recombinant human-derived FKBP3 protein, expressed by E. coli , with N-6*His labeled tag.

Background

FKBP3, also known as FK506-binding protein 3, is a member of the FK506- and rapamycin-binding protein (FKBP) family, which acts as receptors for the immunosuppressants FK506 and rapamycin. These proteins play a crucial role in inhibiting T-cell proliferation by disrupting two distinct cytoplasmic signal transmission pathways. FKBP3, like other members of the family, possesses peptidyl-prolyl isomerase (PPIase) activity, which accelerates the folding of proteins. The PPIase function of FKBP3 is significant in facilitating the proper conformation and maturation of proteins, emphasizing its role beyond immunosuppression in cellular processes related to protein folding.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q00688 (M1-D224)

Gene ID
Molecular Construction
N-term
6*His
FKBP3 (M1-D224)
Accession # Q00688
C-term
Synonyms
rHuPeptidyl-prolyl cis-trans isomerase FKBP3/FKBP3, His; Peptidyl-prolyl cis-trans isomerase FKBP3; PPIase FKBP3; 25 kDa FK506-binding protein; 25 kDa FKBP; FKBP-25; FK506-binding protein 3; FKBP-3; Immunophilin FKBP25; Rapamycin-selective 25 kDa immunophilin; Rotamase; FKBP25
AA Sequence

MAAAVPQRAWTVEQLRSEQLPKKDIIKFLQEHGSDSFLAEHKLLGNIKNVAKTANKDHLVTAYNHLFETKRFKGTESISKVSEQVKNVKLNEDKPKETKSEETLDEGPPKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQDGTVFDTNIQTSAKKKKNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID

Molecular Weight

Approximately 30.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

FKBP3 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FKBP3 Protein, Human (His)
Cat. No.:
HY-P70403
Quantity:
MCE Japan Authorized Agent: