1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Isomerases (EC 5)
  4. FKBP12 Protein, Mouse (His)

The FKBP12 protein is multifunctional and critical in TGF-β signaling by maintaining TGFBR1 in an inactive conformation, thereby preventing receptor activation in the absence of ligand. It recruits SMAD7 to ACVR1B, blocks the binding of SMAD2 and SMAD3 to the activin receptor complex, and thereby inhibits activin signaling. FKBP12 Protein, Mouse (His) is the recombinant mouse-derived FKBP12 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The FKBP12 protein is multifunctional and critical in TGF-β signaling by maintaining TGFBR1 in an inactive conformation, thereby preventing receptor activation in the absence of ligand. It recruits SMAD7 to ACVR1B, blocks the binding of SMAD2 and SMAD3 to the activin receptor complex, and thereby inhibits activin signaling. FKBP12 Protein, Mouse (His) is the recombinant mouse-derived FKBP12 protein, expressed by E. coli , with N-His labeled tag.

Background

FKBP12, a multifunctional protein, plays a crucial role in maintaining the inactive conformation of TGFBR1, the serine/threonine kinase receptor for TGF-beta, thereby preventing receptor activation in the absence of ligand. This regulatory function contributes to the precise control of TGF-beta signaling. Additionally, FKBP12 recruits SMAD7 to ACVR1B, impeding the association of SMAD2 and SMAD3 with the activin receptor complex and effectively blocking activin signaling. Beyond its role in TGF-beta and activin pathways, FKBP12 exhibits versatility by potentially modulating the activity of the RYR1 calcium channel. Acting as a peptidyl-prolyl cis-trans isomerase (PPIase), FKBP12 accelerates protein folding by catalyzing the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. This diverse array of functions underscores FKBP12's significance in cellular processes and highlights its involvement in various signaling pathways.

Biological Activity

Measured by its ability to convert the substrate, Suc-AAPF-pNA, from Cis to Trans formation. The specific activity is 7800 pmol/min/μg, as measured under the described conditions.

Species

Mouse

Source

E. coli

Tag

N-6*His

Accession

P26883 (G2-E108)

Gene ID
Molecular Construction
N-term
His
FKBP12 (G2-E108)
Accession # P26883
C-term
Protein Length

Partial

Synonyms
Peptidyl-prolyl cis-trans isomerase FKBP1A; FKBP-12; Calstabin-1; FKBP-1A; FKBP1
AA Sequence

GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFTLGKQEVIRGWEEGVAQMSVGQRAKLIISSDYAYGATGHPGIIPPHATLVFDVELLKLE

Molecular Weight

Approximately 13 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

FKBP12 Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FKBP12 Protein, Mouse (His)
Cat. No.:
HY-P76346
Quantity:
MCE Japan Authorized Agent: