1. Recombinant Proteins
  2. Viral Proteins
  3. Bacterial/Fungal Proteins
  4. FimH Protein, E.coli (P.pastoris, His)

FimH Protein, pivotal in regulating length, mediates adhesion for type 1 fimbriae without being essential for fimbriae production. Positioned laterally in the fimbriae structure, FimH primarily binds to D-mannose. FimH integration into fimbriae involves collaborative action with FimF and FimG, emphasizing the coordinated molecular interplay essential for type 1 fimbriae assembly and function. FimH Protein, E.coli (P.pastoris, His) is the recombinant Virus-derived FimH protein, expressed by P. pastoris , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

FimH Protein, pivotal in regulating length, mediates adhesion for type 1 fimbriae without being essential for fimbriae production. Positioned laterally in the fimbriae structure, FimH primarily binds to D-mannose. FimH integration into fimbriae involves collaborative action with FimF and FimG, emphasizing the coordinated molecular interplay essential for type 1 fimbriae assembly and function. FimH Protein, E.coli (P.pastoris, His) is the recombinant Virus-derived FimH protein, expressed by P. pastoris , with N-6*His labeled tag.

Background

FimH protein plays a pivotal role in the intricate regulation of length and serves as a mediator for the adhesion process associated with type 1 fimbriae, albeit not indispensable for fimbriae production. This adhesin assumes a lateral position at intervals within the type 1 fimbriae structure and is primarily responsible for binding to D-mannose. The integration of FimH into the fimbriae structure necessitates the collaborative action of FimF and FimG, emphasizing the coordinated molecular interplay required for the assembly and functional manifestation of type 1 fimbriae.

Species

Virus

Source

P. pastoris

Tag

N-6*His

Accession

P08191 (F22-Q300)

Gene ID

948847  [NCBI]

Molecular Construction
N-term
6*His
FimH (F22-Q300)
Accession # P08191
C-term
Protein Length

Full Length of Mature Protein

Synonyms
fimH; b4320; JW4283Type 1 fimbrin D-mannose specific adhesin; Protein FimH
AA Sequence

FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ

Molecular Weight

Approximately 38 kDa.The reducing (R) protein migratesas 38 kDa in SDS-PAGE may be due to glycosylation.

Glycosylation
Yes
Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

FimH Protein, E.coli (P.pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FimH Protein, E.coli (P.pastoris, His)
Cat. No.:
HY-P71811
Quantity:
MCE Japan Authorized Agent: