1. Recombinant Proteins
  2. Others
  3. Fibrillin-1/Asprosin Protein, Mouse (HEK293, His)

Fibrillin-1/Asprosin Protein, Mouse (HEK293, His)

Cat. No.: HY-P7811
Handling Instructions Technical Support

Fibrillin-1/Asprosin proteins play crucial roles in a variety of biological processes. They regulate osteoblast maturation by controlling the availability of TGF-β and regulating TGF-β and BMP levels. Fibrillin-1/Asprosin Protein, Mouse (HEK293, His) is the recombinant mouse-derived Fibrillin-1/Asprosin protein, expressed by HEK293 , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Fibrillin-1/Asprosin proteins play crucial roles in a variety of biological processes. They regulate osteoblast maturation by controlling the availability of TGF-β and regulating TGF-β and BMP levels. Fibrillin-1/Asprosin Protein, Mouse (HEK293, His) is the recombinant mouse-derived Fibrillin-1/Asprosin protein, expressed by HEK293 , with N-His labeled tag.

Background

The oglycan components are involved in various biological processes. They regulate osteoblast maturation by controlling the availability of TGF-beta and calibrating TGF-beta and BMP levels. They also negatively regulate osteoclastogenesis by binding and sequestering TNFSF11, a factor important for osteoclast differentiation and function. This disrupts TNFSF11-induced signaling and impairs the activation of transcription factor NFATC1, which is important for osteoclast differentiation.

Biological Activity

Measured in a cell proliferation assay using human umbilical vein endothelial cells. The ED50 this effect is 20.33 ng/mL, corresponding to a specific activity is 4.919×104 units/mg.

  • Measured in a cell proliferation assay using human umbilical vein endothelial cells. The ED50 this effect is 20.33 ng/mL, corresponding to a specific activity is 4.919×104 units/mg.
Species

Mouse

Source

HEK293

Tag

N-His

Accession

Q61554 (S2734-H2873)

Gene ID
Molecular Construction
N-term
His
Asprosin (S2734-H2871)
Accession # AAA56840.1
C-term
Synonyms
rMuFibrillin-1/Asprosin, His; Fibrillin-1; Fbn1; Asprosin; Fbn-1
AA Sequence

STNETDASDIQDGSEMEANVSLASWDVEKPASFAFNISHVNNKVRILELLPALTTLMNHNRYLIESGNEDGFFKINQKEGVSYLHFTKKKPVAGTYSLQISSTPLYKKKELNQLEDRYDKDYLSGELGDNLKMKIQILLH

Molecular Weight

Approximately 27-34 kDa due to the glycosylation.

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Fibrillin-1/Asprosin Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Fibrillin-1/Asprosin Protein, Mouse (HEK293, His)
Cat. No.:
HY-P7811
Quantity:
MCE Japan Authorized Agent: