1. Recombinant Proteins
  2. Others
  3. FIBP Protein, Human

FIBP is an intracellular chaperone of acidic fibroblast growth factor (aFGF) and mediates the mitogenic effects of aFGF, affecting cell types through mitosis and inducing morphological changes and differentiation. This gene expresses two isoforms, showing potential functional diversity. FIBP Protein, Human is the recombinant human-derived FIBP protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

FIBP is an intracellular chaperone of acidic fibroblast growth factor (aFGF) and mediates the mitogenic effects of aFGF, affecting cell types through mitosis and inducing morphological changes and differentiation. This gene expresses two isoforms, showing potential functional diversity. FIBP Protein, Human is the recombinant human-derived FIBP protein, expressed by E. coli , with tag free.

Background

The FIBP Protein plays a pivotal role as an intracellular binding partner for acidic fibroblast growth factor (aFGF), a mitogen with broad-ranging effects on various cell types, stimulating mitogenesis and inducing morphological changes and differentiation. FIBP's selective binding to aFGF suggests its potential involvement in mediating the mitogenic actions of aFGF within cells. This gene exhibits two transcript variants encoding different isoforms, highlighting the potential diversity in its functional roles. FIBP demonstrates ubiquitous expression, with prominent levels detected in the testis (RPKM 27.1), brain (RPKM 21.5), and 25 other tissues. Its widespread presence underscores its likely participation in diverse cellular processes across multiple organs.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

O43427-2/NP_004205.2 (M1-D357)

Gene ID
Molecular Construction
N-term
FIBP (M1-D357)
Accession # NP_004205.2
C-term
Synonyms
Acidic fibroblast growth factor intracellular-binding protein; FGF-1 intracellular-binding protein; FIBP
AA Sequence

MTSELDIFVGNTTLIDEDVYRLWLDGYSVTDAVALRVRSGILEQTGATAAVLQSDTMDHYRTFHMLERLLHAPPKLLHQLIFQIPPSRQALLIERYYAFDEAFVREVLGKKLSKGTKKDLDDISTKTGITLKSCRRQFDNFKRVFKVVEEMRGSLVDNIQQHFLLSDRLARDYAAIVFFANNRFETGKKKLQYLSFGDFAFCAELMIQNWTLGAVDSQMDDMDMDLDKEFLQDLKELKVLVADKDLLDLHKSLVCTALRGKLGVFSEMEANFKNLSRGLVNVAAKLTHNKDVRDLFVDLVEKFVEPCRSDHWPLSDVRFFLNQYSASVHSLDGFRHQALWDRYMGTLRGCLLRLYHD

Molecular Weight

40-50 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

FIBP Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FIBP Protein, Human
Cat. No.:
HY-P72641
Quantity:
MCE Japan Authorized Agent: