1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. FHIT Protein, Human (His)

FHIT protein has multiple enzymatic activities, including dinucleoside triphosphohydrolase, adenylate sulfatase and adenosine 5'-monophosphate amidase, and functions as a tumor suppressor. It regulates CTNNB1-mediated transcriptional activation, affecting key genes such as CCND1 and BIRC5. FHIT Protein, Human (His) is the recombinant human-derived FHIT protein, expressed by E. coli , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

FHIT protein has multiple enzymatic activities, including dinucleoside triphosphohydrolase, adenylate sulfatase and adenosine 5'-monophosphate amidase, and functions as a tumor suppressor. It regulates CTNNB1-mediated transcriptional activation, affecting key genes such as CCND1 and BIRC5. FHIT Protein, Human (His) is the recombinant human-derived FHIT protein, expressed by E. coli , with C-His labeled tag.

Background

FHIT protein exhibits dinucleoside triphosphate hydrolase activity, specifically cleaving P(1)-P(3)-bis(5'-adenosyl) triphosphate (Ap3A) to generate AMP and ADP. Additionally, it displays adenylylsulfatase activity, hydrolyzing adenosine 5'-phosphosulfate into AMP and sulfate, as well as adenosine 5'-monophosphoramidase activity, breaking down purine nucleotide phosphoramidates like adenosine 5'-monophosphoramidate (AMP-NH2) to produce AMP and NH2. Acting as a tumor suppressor, FHIT plays a role in modulating transcriptional activation by CTNNB1, influencing the expression of critical genes related to cell proliferation and survival, such as CCND1 and BIRC5. Furthermore, FHIT participates in apoptosis induction through SRC and AKT1 signaling pathways, inhibits MDM2-mediated proteasomal degradation of p53/TP53, and contributes to p53/TP53-mediated apoptosis. The apoptotic effect may involve FHIT's ability to bind Ap3A or related compounds, and it can also be attributed, in part, to its mitochondrial form, which enhances mitochondrial calcium uptake and sensitizes low-affinity Ca(2+) transporters.

Biological Activity

Measured by its ability to inhibit the proliferation of A549 cells. The ED50 for this effect is 0.1098 ng/mL, corresponding to a specific activity is 9.107×106 units/mg.

  • Measured by its ability to inhibit the proliferation of A549 cells.The ED50 for this effect is 0.1098 ng/mL , corresponding to a specific activity is 9.107×106 units/mg.
Species

Human

Source

E. coli

Tag

C-6*His

Accession

P49789 (M1-Q147)

Gene ID
Molecular Construction
N-term
FHIT (M1-Q147)
Accession # P49789
His
C-term
Protein Length

Full Length

Synonyms
Bis(5'-adenosyl)-triphosphatase; AP3A hydrolase; AP3Aase; FHIT
AA Sequence

MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAAALRVYFQ

Molecular Weight

Approximately 18 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 8.0, 10% Glycerol.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Shipping with dry ice.

Documentation

FHIT Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FHIT Protein, Human (His)
Cat. No.:
HY-P75187
Quantity:
MCE Japan Authorized Agent: