1. Recombinant Proteins
  2. Cytokines and Growth Factors CD Antigens Receptor Proteins Enzymes & Regulators
  3. FGF Family Stem Cell CD Proteins Epithelial cell CD Proteins Receptor Tyrosine Kinases Protein Tyrosine Kinases
  4. FGFR-3 FGFR
  5. FGFR-3
  6. FGFR-3 Protein, Mouse (HEK293, His)

The FGFR-3 protein is a tyrosine protein kinase that serves as a cell surface receptor for fibroblast growth factors and controls cellular processes, including proliferation, differentiation, and apoptosis. It is essential for chondrocyte differentiation, proliferation, apoptosis and normal bone development functions. FGFR-3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived FGFR-3 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The FGFR-3 protein is a tyrosine protein kinase that serves as a cell surface receptor for fibroblast growth factors and controls cellular processes, including proliferation, differentiation, and apoptosis. It is essential for chondrocyte differentiation, proliferation, apoptosis and normal bone development functions. FGFR-3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived FGFR-3 protein, expressed by HEK293 , with C-His labeled tag.

Background

FGFR-3 protein is a tyrosine-protein kinase that acts as a cell-surface receptor for fibroblast growth factors and is crucial for regulating cell proliferation, differentiation, and apoptosis. It plays a vital role in chondrocyte differentiation, proliferation, and apoptosis, as well as in normal skeleton development. FGFR-3 also regulates osteogenesis and postnatal bone mineralization in osteoblasts. It can promote apoptosis in chondrocytes but has also been implicated in cancer cell proliferation. Additionally, FGFR-3 is essential for the development of the inner ear and phosphorylates PLCG1, CBL, and FRS2. Ligand binding to FGFR-3 triggers various signaling cascades, including the production of diacylglycerol and inositol 1,4,5-trisphosphate through activation of PLCG1. Phosphorylation of FRS2 leads to the recruitment of GRB2, GAB1, PIK3R1, and SOS1, ultimately activating the RAS, MAPK1/ERK2, MAPK3/ERK1, and AKT1 signaling pathways. FGFR-3 also plays a role in vitamin D metabolism regulation. Aberrant signaling occurs when mutations result in constitutive kinase activation or impair normal FGFR3 maturation, internalization, and degradation. Overexpression or constitutive activation of FGFR-3 promotes the activation of STAT1, STAT5A, and STAT5B. Furthermore, FGFR-3 is involved in postnatal lung development.

Biological Activity

Immobilized FGF basic at 5 µg/mL (100 µL/well) can bind Biotinylated FGFR-3. The ED50 for this effect is 50.77 ng/mL.

  • Immobilized FGF basic at 5 µg/mL (100 µL/well) can bind Biotinylated FGF R3. The ED50 for this effect is 50.77 ng/mL.
Species

Mouse

Source

HEK293

Tag

C-His

Accession

Q61851 (E21-Y367)

Gene ID
Molecular Construction
N-term
FGFR-3 (E21-Y367)
Accession # Q61851
His
C-term
Synonyms
Fibroblast growth factor receptor 3; FGFR-3; CD333; Mfr3; Sam3
AA Sequence

EPPGPEQRVVRRAAEVPGPEPSQQEQVAFGSGDTVELSCHPPGGAPTGPTVWAKDGTGLVASHRILVGPQRLQVLNASHEDAGVYSCQHRLTRRVLCHFSVRVTDAPSSGDDEDGEDVAEDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSISWLKNGKEFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAILGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGPDGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELMETDEAGSVY

Molecular Weight

60-90 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

FGFR-3 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FGFR-3 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P74153
Quantity:
MCE Japan Authorized Agent: