1. Recombinant Proteins
  2. Cytokines and Growth Factors CD Antigens Receptor Proteins Enzymes & Regulators
  3. FGF Family Stem Cell CD Proteins Epithelial cell CD Proteins Endothelial cell CD Proteins Receptor Tyrosine Kinases Protein Tyrosine Kinases
  4. FGFR-1 FGFR
  5. FGFR-1
  6. FGFR-1 alpha (IIIb) Protein, Human (HEK293, His)

FGFR-1 alpha (IIIb) Protein, Human (HEK293, His)

Cat. No.: HY-P75764
Handling Instructions Technical Support

FGFR-1 alpha, a conserved member of the FGFR family, binds acidic and basic fibroblast growth factors, influencing mitogenesis and differentiation. Mutations in FGFR1 cause syndromes and disorders. It exhibits ubiquitous expression, with notable levels in ovary (RPKM 21.8), fat (RPKM 21.4), and 25 other tissues. Alternatively spliced variants contribute to its functional diversity. FGFR-1 alpha (IIIb) Protein, Human (HEK293, His) is a recombinant protein dimer complex containing human-derived FGFR-1 alpha, expressed by HEK293 , with C-His, C-10*His labeled tag. FGFR-1 alpha (IIIb) Protein, Human (HEK293, His), has molecular weight of 60-90 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

FGFR-1 alpha, a conserved member of the FGFR family, binds acidic and basic fibroblast growth factors, influencing mitogenesis and differentiation. Mutations in FGFR1 cause syndromes and disorders. It exhibits ubiquitous expression, with notable levels in ovary (RPKM 21.8), fat (RPKM 21.4), and 25 other tissues. Alternatively spliced variants contribute to its functional diversity. FGFR-1 alpha (IIIb) Protein, Human (HEK293, His) is a recombinant protein dimer complex containing human-derived FGFR-1 alpha, expressed by HEK293 , with C-His, C-10*His labeled tag. FGFR-1 alpha (IIIb) Protein, Human (HEK293, His), has molecular weight of 60-90 kDa.

Background

Fibroblast Growth Factor Receptor 1 alpha (FGFR1), a member of the FGFR family, shares a highly conserved amino acid sequence with other family members and exhibits varying ligand affinities and tissue distributions. Comprising three immunoglobulin-like domains in its extracellular region, a single membrane-spanning segment, and a cytoplasmic tyrosine kinase domain, FGFR1 plays a pivotal role in transducing signals initiated by fibroblast growth factors. It binds both acidic and basic fibroblast growth factors, influencing mitogenesis and differentiation, particularly in limb induction. Mutations in FGFR1 have been linked to several syndromes, including Pfeiffer syndrome, Jackson-Weiss syndrome, and Kallmann syndrome 2, as well as disorders like osteoglophonic dysplasia. Chromosomal aberrations involving this gene are associated with stem cell myeloproliferative disorder and stem cell leukemia lymphoma syndrome. Various alternatively spliced variants, encoding distinct protein isoforms, have been identified, contributing to the functional diversity of FGFR1. The gene exhibits ubiquitous expression across tissues, with notable expression levels in ovary (RPKM 21.8), fat (RPKM 21.4), and 25 other tissues.

Biological Activity

Measured by its ability to inhibit FGF acidic-dependent proliferation of NIH/3T3 mouse fibroblast cells. The ED50 for this effect is 4.134 ng/mL, corresponding to a specific activity is 2.42×10^5 units/mg.

  • Measured by its ability to inhibit FGF acidic-dependent proliferation of NIH/3T3 mouse fibroblast cells. The ED50 for this effect is 4.134 ng/mL, corresponding to a specific activity is 2.42×105 units/mg.
Species

Human

Source

HEK293

Tag

C-His

Accession

P11362-7/NP_056934.2 (R22-K310&A359-E374)&AAB19502 (H1-P47)

Gene ID
Synonyms
Fibroblast growth factor receptor 2; FGFR-2; FGF R2a; FGFR2 alpha
AA Sequence

A1:
RPSPTLPEQAQPWGAPVEVESFLVHPGDLLQLRCRLRDDVQSINWLRDGVQLAESNRTRITGEEVEVQDSVPADSGLYACVTSSPSGSDTTYFSVNVSDALPSSEDDDDDDDSSSEEKETDNTKPNPVAPYWTSPEKMEKKLHAVPAAKTVKFKCPSSGTPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENEYGSINHTYQLDVVERSPHRPILQAGLPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKIGPDNLPYVQILK
A2:
ALEERPAVMTSPLYLE
A3:
HSGINSSDAEVLTLFNVTEAQSGEYVCKVSNYIGEANQSAWLTVTRP

Molecular Weight

60-90 kDa

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

FGFR-1 alpha (IIIb) Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FGFR-1 alpha (IIIb) Protein, Human (HEK293, His)
Cat. No.:
HY-P75764
Quantity:
MCE Japan Authorized Agent: