1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. FGF Family
  4. Fibroblast Growth Factor
  5. FGF-2/bFGF
  6. FGF basic/bFGF Protein, Human (P. pastoris, N-His)

FGF basic/bFGF Protein, Human (P. pastoris, N-His)

Cat. No.: HY-P700479
Handling Instructions Technical Support

FGF basic, or bFGF (fibroblast growth factor basic), initiates at an alternative CUG codon, marking a distinctive feature in translational initiation. This alternative start codon plays a pivotal role in regulating the expression and functional properties of FGF basic. FGF basic/bFGF Protein, Human (P. pastoris, N-His) is the recombinant human-derived FGF basic/bFGF protein, expressed by P. pastoris , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE FGF basic/bFGF Protein, Human (P. pastoris, N-His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

FGF basic, or bFGF (fibroblast growth factor basic), initiates at an alternative CUG codon, marking a distinctive feature in translational initiation. This alternative start codon plays a pivotal role in regulating the expression and functional properties of FGF basic. FGF basic/bFGF Protein, Human (P. pastoris, N-His) is the recombinant human-derived FGF basic/bFGF protein, expressed by P. pastoris , with N-6*His labeled tag.

Background

Initiation of FGF basic, also known as bFGF (fibroblast growth factor basic), occurs at an alternative CUG codon. This alternative start codon represents a distinctive feature in the translational initiation of the protein, contributing to the unique regulatory mechanisms governing the expression and functional properties of FGF basic.

Biological Activity

Measured in a cell proliferation assay using NIH/3T3 mouse fibroblast cells. The ED50 for this effect is 0.9354 ng/mL, corresponding to a specific activity is 1.07×10^6 units/mg.

  • Measured in a cell proliferation assay using NIH/3T3 mouse fibroblast cells. The ED50 for this effect is 0.9354 ng/mL, corresponding to a specific activity is 1.07×106 units/mg.
Species

Human

Source

P. pastoris

Tag

N-6*His

Accession

P09038-4 (P143-S288)

Gene ID
Molecular Construction
N-term
6*His
bFGF (P143-S288)
Accession # P09038-4
C-term
Protein Length

Full Length of Isoform-4 Mature Protein

Synonyms
Fibroblast Growth Factor 2; FGF-2; Basic Fibroblast Growth Factor; bFGF; Heparin-Binding Growth Factor 2; HBGF-2; Fgf2; Fgf-2
AA Sequence

PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Molecular Weight

17.9-20 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 or PBS, 6% Trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

FGF basic/bFGF Protein, Human (P. pastoris, N-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FGF basic/bFGF Protein, Human (P. pastoris, N-His)
Cat. No.:
HY-P700479
Quantity:
MCE Japan Authorized Agent: