FGF2 Protein, Chicken (His)

FGF2 Protein acts as a ligand for FGFR1-4 and an integrin ligand for FGF2 signaling. It regulates cell survival, division, differentiation, and migration. FGF2 Protein is a strong mitogen and can induce angiogenesis. FGF2 Protein, Chicken (His) is the recombinant FGF2 protein, expressed by E. coli , with C-6*His labeled tag.

The FGF2 protein serves as a ligand for FGFR1, FGFR2, FGFR3, and FGFR4, as well as an integrin ligand necessary for FGF2 signaling. It plays a crucial role in regulating cell survival, division, differentiation, and migration. Additionally, FGF2 functions as a potent mitogen in vitro and has the ability to induce angiogenesis.

Others

E. coli

C-6*His

P48800 (P13-S158)

396413  [NCBI]

Full Length of Mature Protein

PALPDDGGGGAFPPGHFKDPKRLYCKNGGFFLRINPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVSANRFLAMKEDGRLLALKCATEECFFFERLESNNYNTYRSRKYSDWYVALKRTGQYKPGPKTGPGQKAILFLPMSAKS

27 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.