1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. FGF Family
  4. Fibroblast Growth Factor
  5. FGF-14
  6. FGF-14 Protein, Canine

Fibroblast growth factor 14 is a bioactive protein found in the brain and pituitary gland that promotes fibroblast growth and is involved in embryonic development, angiogenesis, tissue repair and other processes. FGF-14 plays a neuroprotective role in in vitro Alzheimer's disease (AD) models by inhibiting MAPK signaling. FGF-14 Protein, Canine is the recombinant canine-derived FGF14 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Fibroblast growth factor 14 is a bioactive protein found in the brain and pituitary gland that promotes fibroblast growth and is involved in embryonic development, angiogenesis, tissue repair and other processes. FGF-14 plays a neuroprotective role in in vitro Alzheimer's disease (AD) models by inhibiting MAPK signaling. FGF-14 Protein, Canine is the recombinant canine-derived FGF14 protein, expressed by E. coli , with tag free.

Background

Fibroblast growth factor 14 is a bioactive protein found in the brain and pituitary gland that promotes fibroblast growth and is involved in embryonic development, angiogenesis, tissue repair and other processes. As a member of the FGF homologous factor family, FGF14 is expressed in the developing and mature nervous system and maintains normal nervous system function by regulating the plasticity and excitability of neurons. Mutations in the FGF14 gene are responsible for the neurodegenerative spinocerebellar ataxia (SAC27), and FGF14 deficiency pimples on the maturation of cells in the hippocampal dentate gyrus, which may lead to schizophrenia. FGF14 plays a neuroprotective role in in vitro Alzheimer's disease (AD) models by inhibiting MAPK signaling[1][2][3].

Biological Activity

Measured by its binding ability in a functional ELISA. When Recombinant Canine FGF14 is present at 2 μg/mL, can bind Recombinant Human FGFR4. The ED50 for this effect is 299.1 ng/mL.

  • Measured by its binding ability in a functional ELISA. When Recombinant Canine FGF14 is present at 2 μg/mL, can bind Recombinant Human FGFR4.The ED50 for this effect is 299.1 ng/mL.
Species

Canine

Source

E. coli

Tag

Tag Free

Accession

XP_003363267.1 (K64-T252)

Gene ID

100050897  [NCBI]

Molecular Construction
N-term
FGF-14 (K64-T252)
Accession # XP_003363267.1
C-term
Protein Length

Partial

Synonyms
Fibroblast growth factor 14; FHF-4; FGF14
AA Sequence

KNKNPTDPQLKGIVTRLYCRQGYYLQMHPDGALDGTKDDSTNSTLFNLIPVGLRVVAIQGVKTGLYIAMNGEGYLYPSELFTPECKFKESVFENYYVIYSSMLYRQQESGRAWFLGLNKEGQVMKGNRVKKTKPAAHFLPKPLEVAMYREPSLHDVGETVPKAGVTPSKSTSASAIMNGGKPVNKSKTT

Molecular Weight

Approximately 21 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

FGF-14 Protein, Canine Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FGF-14 Protein, Canine
Cat. No.:
HY-P77365
Quantity:
MCE Japan Authorized Agent: