FGF-4 Protein, Human

FGF-4 Protein is an important member of the fibroblast growth factor (FGF) family. By binding to FGFRs (especially FGFR1 and FGFR2), FGF-4 Protein can activate downstream signaling pathways such as RAS-MAPK and PI3K-AKT. FGF-4 Protein plays a key role in physiological processes such as cell growth, differentiation, migration, and angiogenesis. FGF-4 Protein, Human is a recombinant FGF-4 protein expressed by E. coli without a tag^[1][2][3].

FGF-4 Protein is encoded by the hst oncogene. FGF-4 Protein can bind to the FGFR2 receptor through autocrine/paracrine actions to stimulate endothelial cell proliferation and angiogenesis. However, when overexpressed, its ability to induce cell transformation and invasion is weaker than that of FGF-2, and it cannot trigger hemangiomas^[1].

FGF-4 Protein (1.0-10 ng/mL; 20 min-22 h) can stimulate DNA synthesis and ERK1/2 phosphorylation in mouse aortic endothelial cells^[1].
FGF-4 Protein (Human; 25 ng/mL) can be used for the preparation of trophoblast stem cell (TSCs) culture medium to maintain the proliferation and stemness of TSCs^[2].
FGF-4 Protein (Human; 5-25 ng/mL; 12-24 days) can promote the proliferation of human bone marrow-derived mesenchymal stem cells without affecting cell phenotype and pluripotency^[3].

The ED₅₀ is ≤1.5 ng/mL as measured by 3T3 cells, corresponding to a specific activity of ≥6.67 × 10⁵ units/mg.

• 
  Measured in a cell proliferation assay using NIH/3T3 cells. The ED₅₀for this effect is 1.38 ng/mL, corresponding to a specific activity is 7.246×10⁵ units/mg.

Human

E. coli

Tag Free

P08620-1 (A31-L206)

2249  [NCBI]

Full Length of Isoform-1 Mature Protein

APTAPNGTLEAELERRWESLVALSLARLPVAAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL

Approximately 19.4 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of 50 mM HEPES, 750 mM NaCl, pH 7.5 or 50 mM HEPES, 750 mM NaCl, pH 7.5, 8% trehalose.

<0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Dell'Era P, et al. Paracrine and autocrine effects of fibroblast growth factor-4 in endothelial cells. Oncogene. 2001 May 10;20(21):2655-63.  [Content Brief]

  [2]. Zhang W, et al. Capture of Totipotency in Mouse Embryonic Stem Cells in the Absence of Pdzk1. Adv Sci (Weinh). 2025 Feb;12(6):e2408852.  [Content Brief]

  [3]. Farré J, et al. FGF-4 increases in vitro expansion rate of human adult bone marrow-derived mesenchymal stem cells. Growth Factors. 2007 Apr;25(2):71-6.  [Content Brief]